KEGG   Altererythrobacter atlanticus: WYH_01550Help
Entry
WYH_01550         CDS       T03925                                 

Gene name
gutB
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
aay  Altererythrobacter atlanticus
Pathway
aay00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:aay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    WYH_01550 (gutB)
Enzymes [BR:aay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     WYH_01550 (gutB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     WYH_01550 (gutB)
    1.1.1.-  
     WYH_01550 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2 2-Hacid_dh_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AKH42589
UniProt: A0A0F7KSM7
Position
1602626..1603627
Genome map
AA seq 333 aa AA seqDB search
MKAATFQALHEPLKVETLPDPVPDAGQVVVEVGRCGICGSDLHMTEDAAYGCKHGDILGH
EFAGEVVGLGSEVEGLKTGDLISVIPLMSCGTCEYCHRGEVQWCEEFGLQGGGYAQFALT
RPNQCVKLPVDVSIADGAIVEPLAVALHGVNLSGMKTGDKVLVLGAGPIGLAVAFWAKRF
GASRVAVQDIAEFQHNRALDMGADIFVVDPSDPVGSAERALGGKADVVFECVGIPGLIQQ
GVEQVRNDGTICLLGLCTKPDTLNTFAMLSKQVKLVTSAFFTRQEYEAALEALLRGAMEP
RLLVTDTISLDETPEVFESLKQRGPQCKVLIAP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcgaccttccaggccctgcatgaaccgctgaaggtggaaaccctgcccgat
ccggtgccggatgccgggcaggtcgtggtggaggtcggccgctgcggcatctgcggcagc
gacctgcacatgaccgaggatgcagcctatggctgcaagcatggcgatatcctcggccat
gaattcgccggcgaagtggtcgggcttggcagcgaggtcgaagggctgaagacgggagat
ctcatttccgtcatcccgctgatgagctgcggcacctgcgaatattgccaccgcggcgaa
gtgcaatggtgcgaagaattcggcctgcagggcggtggctatgcccaattcgccctcacc
cgccccaatcaatgcgtgaagctgccggtggatgtttccatcgcggatggcgccattgtg
gaaccgctggccgtggcgctgcacggcgtgaatctttcgggcatgaaaacgggcgacaag
gtgctggtgctcggcgccggacctatcgggctggccgttgccttctgggccaagaggttc
ggcgcatcccgggtggcggtgcaggacattgccgaattccagcacaaccgcgcgctggac
atgggggcggatatcttcgtggtcgatccgtccgacccggtgggaagcgcggaaagagcg
ctgggcggcaaggcggatgtggtgttcgaatgcgtgggcattcccggcctgatccagcaa
ggcgtggaacaggtgcgcaatgacggcacgatctgcctgctcggcctgtgcacgaagccg
gacacgctcaacactttcgccatgctcagcaagcaggtgaaactggtgaccagcgccttc
ttcacgcggcaggaatatgaagccgcgctggaggcgctgctgcgcggggcaatggaaccg
cgcctgctggtgaccgatacgatcagcctggacgaaacgccggaagtgtttgaaagcctc
aagcagcgcggtccgcaatgcaaggtgctgatcgcgccctga

DBGET integrated database retrieval system