KEGG   Altererythrobacter atlanticus: WYH_02088Help
Entry
WYH_02088         CDS       T03925                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase-2
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
aay  Altererythrobacter atlanticus
Pathway
aay00740  Riboflavin metabolism
aay00790  Folate biosynthesis
aay01100  Metabolic pathways
aay01110  Biosynthesis of secondary metabolites
aay02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:aay00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    WYH_02088 (ribA)
   00790 Folate biosynthesis
    WYH_02088 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    WYH_02088 (ribA)
Enzymes [BR:aay01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     WYH_02088 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AKH43122
UniProt: A0A0F7KV60
Position
2168491..2169615
Genome map
AA seq 374 aa AA seqDB search
MGKTFRPRPADYGVFSLKGAALTPSPSRRVAQAIDGLRHGWPLAIDGAPLLLPAETAIRR
EASTARMLISAARAATLQLANQREAARPHAPVLIRAAEQLDLGAAQAIADPSLDLAAPLK
GPFRAEPLQWNRAATAALELARLAGILPAFLVGAEPADEPVAVEPGDLETFADTQALTIA
TRARLPVAACEETEIVAFRSANDLREHVALVIGTQNADRIPLVRLHSECLTGDILGSLKC
DCGPQLDTALSAMAVEVAQGGWGVLLYLRQEGRGIGLINKLRAYRLQDQGFDTLEANRRL
GLPEEARDFPVAARMMDLLGLWSIRLLTNNPAKVAALQQCGITVAERVPHHLAPNPHNAR
YLATKRDKSGHLFE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaccttccgaccacgtcccgctgattacggagttttctctctgaaaggcgcg
gcgctcaccccatcgccatcgcggcgcgtggcgcaggccatcgatggcttgcgtcatggc
tggccgctggcgatcgacggggcgccattgctgcttcccgccgaaaccgcgatacggcgg
gaagcgagcacggcgagaatgctgatttcggcagcccgcgctgcgactttgcaacttgcc
aatcagcgtgaagcagcccggccccatgcccctgtgctgatccgcgcggcggagcagctg
gaccttggggcggcccaggccatcgccgatccttcgctggatctcgccgccccgctcaaa
gggccgtttcgggcggaacccctgcaatggaaccgcgccgcaaccgccgcgctggaactg
gcccggctggccggcatattgcccgccttcctggtcggagccgaaccggcggatgaaccc
gtggcagtggaaccgggtgatctggaaacctttgccgatacacaggcgctgaccattgcg
acccgcgcacgcctgcccgtggcggcgtgcgaagagacggaaatagtcgcatttcgcagc
gccaatgatctgcgtgaacatgtcgcgcttgtcatcggtacgcagaatgcagaccggatt
ccgctggtgcggcttcattccgaatgcctgacaggggatattctcggcagtctcaaatgc
gattgcgggccgcagcttgataccgccctttcagccatggcagtggaagttgcgcagggc
ggatggggggtgctgctctatctgcgccaggaagggcgcgggatcggcctgatcaacaaa
ttgcgcgcctatcgcctgcaggatcaggggtttgacacgctggaggccaatcgccgactg
ggcctgcccgaggaagcacgggatttcccggtggccgcgcgcatgatggatctgctcggc
ctgtggtcgatccggttgctgaccaataatccggccaaggtggccgccttgcagcaatgc
ggcattaccgtggcagagcgtgtgccccaccacctggcgccaaacccgcataatgcgcgt
tatctggccaccaaacgcgacaagtcaggacatttgttcgaatga

DBGET integrated database retrieval system