KEGG   Altererythrobacter atlanticus: WYH_02188Help
Entry
WYH_02188         CDS       T03925                                 

Gene name
aldH
Definition
(GenBank) NADP-dependent fatty aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
aay  Altererythrobacter atlanticus
Pathway
aay00040  Pentose and glucuronate interconversions
aay00053  Ascorbate and aldarate metabolism
aay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    WYH_02188 (aldH)
   00053 Ascorbate and aldarate metabolism
    WYH_02188 (aldH)
Enzymes [BR:aay01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     WYH_02188 (aldH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKH43221
UniProt: A0A0F7KVP1
Position
2281222..2282790
Genome map
AA seq 522 aa AA seqDB search
MTITGENFVAGVRRPSNEKFRARDASSGEEFGEEFAAASKDDVADACSAAAEAQWEFAAL
PAAARARFLRKVADRIDALGETLTRRAMQETGLPEARLTGERGRTVGQLRLFADEVEEGG
WLDLRIDHADAGRTPPKPDLRLRKIPLGPVAVFGASNFPLAFSVAGGDTASALAAGCCVV
VKAHPAHPGTSELVAGAIAQAVAEEGLPAGVFSMLHGPSNALGEALVTDPRISAVGFTGS
RSGGLALMRHAASRPVPIPVYAEMSSVNPVIILPHIMAQSAEDLGRAYVGSLTMGVGQFC
TNPGIVLTLGGEPFDRFIYNVAQAIAEVPANTMLTGGISDAYRAGSQRLGGFDGVSLVGM
GGDGTSLCGQAQVYTCDGTSFAAQPDLADEVFGPASLVVRCDSMEQMREILGNMEGQLTT
SLHMIPQDYEAAGRLMPVLEKLAGRIIANGWPTGVDVTHAMVHGGPFPATSDGRSTSVGT
MAIDRFLRPVSYQDMPDELLPEMLRGHGANIPVRIDGKRQFG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcaccggggaaaattttgttgctggcgtccgccgcccaagcaacgagaaattc
agggcaagggatgcttcgtcgggcgaggaattcggcgaggaatttgctgccgcgagcaag
gatgacgtggccgatgcctgctccgccgcagcggaagcgcaatgggaattcgccgccctt
ccggcagcggcaagggcccgcttcctgcgcaaggttgcggaccggatcgatgcactgggt
gaaacgcttacccgccgggccatgcaggaaaccggactgcccgaagcccggctgaccggc
gaacggggccgcacggtcggacaattgcggctgtttgccgatgaagtggaggaaggcggc
tggctcgatctgcgcatagaccatgccgatgccggccgcacgccgccaaagcctgatctg
cgcctgcgcaagataccgctcggccccgtggccgtattcggcgcaagcaatttcccgctg
gcattttctgtcgccggaggtgacacggcaagcgccctcgccgcggggtgctgcgtcgtc
gtcaaggcgcatcccgcccaccccggcacatcggaacttgtcgccggggccatcgcccag
gccgttgccgaagaagggctgccggcaggcgtcttctcgatgcttcacgggccttccaac
gcccttggcgaagcgcttgtcaccgatccgcgaatatcggcagtgggcttcaccggatcg
cgttccggcgggctcgccctgatgcgccatgccgccagccgccctgttccaatccccgtc
tatgcggaaatgagcagtgtgaatccggtcatcatcctcccccacatcatggcgcaatcc
gccgaagatctgggacgggcctatgtcggatcgctgaccatgggcgtgggccagttctgc
accaatcccggcatcgtcctgacccttgggggcgaaccgttcgaccgcttcatctacaat
gttgcgcaggccatcgcggaagtgcccgccaataccatgctgacgggcgggataagcgac
gcctatcgcgcgggaagccagcgccttggcgggtttgacggcgtcagcctggtgggcatg
ggaggtgacggcacaagcctttgcggacaggcgcaggtctatacgtgcgatggcaccagc
ttcgccgcccagcccgaccttgccgatgaagtattcggcccggcatcgctggtcgtccgg
tgcgacagcatggagcagatgcgcgaaatcctgggcaacatggaaggccagctgaccacg
tcactgcatatgatcccgcaggattacgaggcggcgggacggctgatgcccgttctggaa
aagctggcaggccgcatcatcgccaatggctggccaaccggggtcgatgtcacacatgcg
atggtccatggcggcccgttccccgccacttctgacggacgcagcacctctgtcgggacg
atggcgatagatcggttccttcgtccggtgtcctatcaggatatgccggacgagcttttg
ccggagatgctgcgcggtcacggggcgaatatcccagtcaggatcgacggcaagcggcag
ttcggctga

DBGET integrated database retrieval system