KEGG   Altererythrobacter atlanticus: WYH_03187Help
Entry
WYH_03187         CDS       T03925                                 

Gene name
qbdA_5
Definition
(GenBank) Quinohemoprotein alcohol dehydrogenase ADH IIB precursor
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
aay  Altererythrobacter atlanticus
Brite
KEGG Orthology (KO) [BR:aay00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WYH_03187 (qbdA_5)
Enzymes [BR:aay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     WYH_03187 (qbdA_5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ_2 PQQ PQQ_3 Cytochrome_CBB3 Cytochrom_C Cytochrom_C1
Motif
Other DBs
NCBI-ProteinID: AKH44206
UniProt: A0A0F7KY83
Position
3317935..3320031
Genome map
AA seq 698 aa AA seqDB search
MMLFRKRASAFAGAIFAPLCAFALAGCSALAGDADPLSDPAAGEWLSDGRTYSAQRYSPL
TQIDASNVGELGLAWYDDLDTYRGVEATPLYSDGVLYNILPFNITIAYDAKTGERLWTFD
PEVPREMGRYACCEPVSRGLAMWNDKIIIATLDGRLIGLDRKTGEQVWSTRTFDNEKYAY
TITGAPRVFDGKVVIGQSGGDFGVRGFVIALDADTGEKLWKFYLAPGNPADGPDGEASDP
IMEMIRKTWFGDKYWELGGGANAWDSIAYDPENKLVFVGTGNGSPLSRYHRSENKGDNLF
LCSIVALHAETGEYAWHYQMVPGEDWDYTCTSSIVSADLEIDGKQRQVIMQAPKNGFYYV
LDRKTGELISAESYVKVNWSSGPDPETGRMIVNPEVRYGTDPVLVYPGPGGAHNWFPMAY
SPRTKLAYFPAYQSGRTYALDPDFKAKPFRSNSGWGGYGPHQIDRTLALQKEGDKDEQAF
LVAYDPVKQEIAWKVDLPRHGNGGVFVTASDLVFEGTTKQTFAAFDANTGEQLWEFPTQS
APVAGGITYELDGEQYIAINAGWGGGAAQIERGAGIELPRSPARLLVFKLGGSAQLPPLA
AQEPVPPPPPLRASEAVVQRGAKLYADTCSQCHGDNAVGGVKDLRHMSAEAHEKFRQIVL
EGLYLDKGMASFADLIDEEEADAIHAYLIARANEDWGE
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgttccgaaaacgcgcatccgcttttgccggagcaattttcgcgccgctctgc
gcgttcgcccttgctggttgttccgccctggcaggcgatgcggatccgctgtccgatccc
gccgcaggcgaatggcttagcgacgggcgaacctattccgcgcagcgatacagcccgctg
acgcagatcgatgcgtccaatgtcggggaactgggcctggcctggtatgacgatctcgat
acttatcgcggggtggaggcgacgccgctttattccgatggcgtgctctacaacatcctg
cccttcaacatcaccatcgcctatgacgcgaagacgggggaacggctgtggacctttgac
cccgaagtgccgcgtgagatgggccgttatgcctgctgcgaacccgtgtcgcgcgggctg
gccatgtggaatgacaagatcatcatcgccactttggacgggcggctgatcggcctggac
aggaagactggcgaacaggtctggtccacccggaccttcgataatgaaaaatatgcctat
acgatcaccggcgcgccgcgtgtgttcgatggcaaggtggttatcggccagtctggcggc
gatttcggcgtgcgcggtttcgtgatcgccctggacgccgataccggggagaagctctgg
aaattctatctcgccccgggcaatccggcggacggccccgatggcgaagcgtcggacccg
atcatggagatgatccgcaagacctggttcggggacaagtactgggaactgggcggcggc
gccaatgcctgggattccatcgcctatgacccggaaaacaagctggtattcgtcggcacc
ggcaatggttcgcccttgtcacgctatcaccgcagcgagaacaagggggacaatctgttc
ctctgttcgatcgtggcccttcatgccgaaaccggcgaatatgcctggcactatcagatg
gttccaggggaagactgggattacacctgcaccagttccatcgtcagcgccgatctggaa
atcgatggcaagcagcgccaggtcatcatgcaggcgcccaagaacgggttctattatgtg
ctggaccgcaagacgggcgaactgatcagcgctgaaagctatgtgaaggtcaactggtcc
agcgggccggacccggaaacgggccggatgatcgtcaacccggaagtccgttatggcacc
gatccggtgctggtctatccggggccgggcggggcgcataactggttccccatggcctat
agcccgcgcacgaagctggcctattttccggcctatcaatcggggcggacctatgcgctg
gatcccgatttcaaggccaagcctttccggtccaattccggttggggcgggtatggcccg
catcagatcgaccggacgctggccctgcagaaggaaggggacaaggacgaacaggccttc
ctggtcgcctatgatccggtgaagcaggaaatcgcctggaaggttgatctgccccgccac
ggcaatggcggcgtgttcgtgaccgcttccgatctcgtctttgaagggacaacgaagcag
accttcgctgccttcgacgcgaatacgggcgagcaattatgggagtttccgacacagagc
gccccggtggcgggcggcatcacatatgaactggatggcgaacaatatatcgccatcaat
gctggctggggcggcggcgccgcgcagatagagcgtggggcaggcatcgaattgccgcgc
tcgcccgcgcgcctgcttgtattcaagctgggcggaagcgcgcaattgccgccgcttgcg
gcgcaggaacccgtgccgccgccaccgccgctccgcgcgagcgaagccgtggtccagcgc
ggggcgaagctttatgccgatacctgttcgcaatgccatggcgacaatgccgtgggcggg
gtcaaagacctccggcatatgagcgccgaagcgcatgagaagttcaggcagatcgtgctg
gaagggctctatctggacaagggcatggcttccttcgccgacctgatcgacgaggaagag
gcggatgccatccacgcctatctgatcgcgcgcgccaacgaggattggggcgaataa

DBGET integrated database retrieval system