KEGG   Aggregatibacter aphrophilus W10433: ADJ80_00740Help
Entry
ADJ80_00740       CDS       T04521                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
aaz  Aggregatibacter aphrophilus W10433
Pathway
aaz00010  Glycolysis / Gluconeogenesis
aaz00020  Citrate cycle (TCA cycle)
aaz00620  Pyruvate metabolism
aaz01100  Metabolic pathways
aaz01110  Biosynthesis of secondary metabolites
aaz01120  Microbial metabolism in diverse environments
aaz01130  Biosynthesis of antibiotics
aaz01200  Carbon metabolism
Module
aaz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ADJ80_00740
   00020 Citrate cycle (TCA cycle)
    ADJ80_00740
   00620 Pyruvate metabolism
    ADJ80_00740
Enzymes [BR:aaz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     ADJ80_00740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AKU62392
UniProt: A0A3M6PLL0
Position
complement(155956..157572)
Genome map
AA seq 538 aa AA seqDB search
MTDLSKVIKELEALGIHDVKEVVYNPSYEQLFEEETKPGLEGFEKGTLTTTGAVAVDTGI
FTGRSPKDKYIVLDDTTKNTVWWTSDAAKNDNKPMTQETWTSLKGLVTKQLSNKRLFVID
GFCGASEKDRIAVRIVTEVAWQAHFVKNMFIRPTEAELKDFKPSFVVMNGSKCTNPNWKE
QGLNSENFVAFNLTERVQLIGGTWYGGEMKKGMFSMMNYFLPLKGVGAMHCSANVGKDGD
VAVFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDVGIFNFEGGCYAKTIHLSEENEPDIYR
AIRRDALLENVVVRADGSVDFDDGSKTENTRVSYPIYHIDNIVKPVSRAGHATKVIFLTA
DAFGVLPPVSKLTPEQTKYYFLSGFTAKLAGTERGITEPTPTFSACFGAAFLTLHPTQYA
EVLVKRMQAAGAEAYLVNTGWNGTGKRISIKDTRGIIDAILDGSIEKAEMGELPIFDLAI
PKALPGVDPAILDPRDTYADKAQWEAKAKDLAGRFVKNFEKYATNAEGKALIAAGPKA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgactgacttaagtaaagttattaaagagcttgaagcacttggtattcacgatgtcaaa
gaagttgtttataacccaagttatgaacaattatttgaagaagaaaccaaacctggctta
gaaggttttgaaaaaggtactttgaccacaaccggcgcggtagctgttgataccggcatc
tttactggtcgttcaccgaaagataagtatattgtgttagacgatactaccaaaaatact
gtttggtggacttccgatgcagcgaaaaacgataataaaccaatgacccaagaaacttgg
actagcttgaaaggtcttgtaactaaacaactttccaacaaacgtctattcgtgattgat
ggtttctgcggcgccagtgaaaaagaccgtattgccgtgcgtatcgtaactgaagtggcg
tggcaagcgcattttgtgaaaaacatgtttattcgtccaaccgaagctgaattaaaagat
ttcaaaccaagcttcgtggtaatgaatgggtctaaatgcaccaacccgaattggaaagag
caaggtttgaactctgaaaactttgtggcattcaacttaaccgaacgtgttcagttaatc
ggtggtacttggtacggcggcgaaatgaagaaaggtatgttctccatgatgaactacttc
cttccacttaaaggcgtaggtgcaatgcactgttctgctaacgtaggtaaagatggcgac
gttgcagtattctttggtttgtccggtactggtaaaaccacgctttctactgatccgaaa
cgtcaattaatcggtgacgatgaacacggttgggatgatgtaggtatcttcaactttgaa
ggtggttgctacgcgaaaaccattcacctttctgaagaaaatgaaccggatatttatcgc
gcaatccgtcgtgatgcattattagaaaacgtagttgttcgtgcagacggttctgttgat
ttcgatgacggttcaaaaactgaaaacacccgtgtgtcctatccgatttatcatatcgat
aacatcgtaaaaccggtttcccgtgcaggtcatgcaaccaaagtgattttcttaaccgca
gatgcattcggcgtattgccaccggtttctaaattaacaccggaacaaactaaatactac
ttcttatccggctttactgcaaaattagcgggtacagaacgtggtattaccgaaccaaca
ccaactttctcagcttgtttcggtgcagcattcttaactttacacccaactcaatatgcg
gaagtgttggttaaacgtatgcaagcggcaggtgcagaagcttacttggtaaacaccggt
tggaacggtacgggtaaacgtatctctattaaagatacccgtggtattattgatgctatc
ttagatggttctatcgaaaaagctgaaatgggcgagttaccaatctttgatttagcgatt
ccaaaagctttaccgggcgtagatcctgcgattttagatccgcgtgacacctacgcagac
aaagcgcaatgggaagctaaagcgaaagatcttgccggtcgtttcgtgaagaacttcgaa
aaatatgcaacaaatgcagaaggtaaagcattaattgcggctggtcctaaagcgtaa

DBGET integrated database retrieval system