KEGG   Aggregatibacter aphrophilus W10433: ADJ80_08490Help
Entry
ADJ80_08490       CDS       T04521                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
aaz  Aggregatibacter aphrophilus W10433
Brite
KEGG Orthology (KO) [BR:aaz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aaz03016]
    ADJ80_08490
Enzymes [BR:aaz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     ADJ80_08490
Transfer RNA biogenesis [BR:aaz03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    ADJ80_08490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AKU63784
UniProt: A0A3M6PFA9
Position
complement(1822564..1823274)
Genome map
AA seq 236 aa AA seqDB search
MLEILYQDDVLVAVNKPAGMLVHRSWLDRHETQFIMQTLRDQIGQLVYPIHRLDRPTSGV
LLFALNSEIANLLCQQFEQKQTEKQYLAVVRGYVTGHGEIDYPLKIQLDKIADKFSQQDK
APQSAVTFYEGLQTVEMPYGVGRYATSRYSLMRLVPKTGRKHQLRRHMKHIFHPILGDTQ
YGDLHQNRALTEHTGCSRLMLHAEKLTFVHPLTQLPITIQAGLDPQWRNLMQTFQW
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgttagagattttatatcaggatgatgtattggtcgccgtaaacaaaccggcgggaatg
ttggtacatcgcagttggcttgatcgccatgaaacacaatttattatgcaaaccttacgc
gatcaaatcgggcagctggtttatcctattcatcgattagatcgtccgacatccggcgtt
ctgctttttgccttaaacagtgaaatagctaatttgttatgccaacagtttgagcaaaaa
caaacggaaaaacagtatttagctgtagttagaggatatgtgacagggcatggcgaaatt
gattatccgctaaagattcagttagataaaattgccgataagttttctcaacaggataaa
gcgccacaaagtgcggtcactttttatgaaggattgcagaccgtggaaatgccttacggt
gtagggcgttatgccacttcccgttattctttgatgcgtttggtaccgaaaacggggcgt
aagcaccagttacgtcgtcacatgaagcatatttttcacccgattttaggggatacacaa
tatggtgatttacatcaaaatcgtgctttaacggagcacaccggctgttcccgtttaatg
ttacacgcggaaaaattaacctttgttcatccgttgactcaacttccgattacgattcag
gcaggattggatccgcaatggcggaatttaatgcaaacttttcagtggtaa

DBGET integrated database retrieval system