KEGG   Aggregatibacter aphrophilus W10433: ADJ80_09145Help
Entry
ADJ80_09145       CDS       T04521                                 

Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
aaz  Aggregatibacter aphrophilus W10433
Pathway
aaz00564  Glycerophospholipid metabolism
aaz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ADJ80_09145
Enzymes [BR:aaz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     ADJ80_09145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf Vps55
Motif
Other DBs
NCBI-ProteinID: AKU63904
UniProt: A0A3M6PGW8
Position
1982127..1982684
Genome map
AA seq 185 aa AA seqDB search
MKLNIPIFLTIFRVILIPFFIIAFYLPFDWAPFLTTFIFFIAGVTDWLDGYLARKWKQTT
SFGAFLDPVADKVMVVAGLVLVVEYNHTFWITLPAIVVISREIIISALREWMAELGSRSK
VAVSWLGKVKTTSQMLALGGLLWRYNIYMEVAAIILLYIAAILTIWSMLQYLIAAKDSLL
EDLRK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaacatccctatttttctgacgatatttcgagttattttaattccttttttc
attattgctttctatcttccctttgattgggctccttttttaaccacgtttatttttttc
attgccggtgtcacagactggcttgacggctatcttgcccgcaaatggaagcaaaccacc
agtttcggcgcatttttagacccggtggcagataaagtaatggtggttgcggggttggta
ttagtggtggaatataatcataccttttggattactttgccggccattgtagtgatttcc
cgagaaattatcatttctgccttgcgcgaatggatggctgaattaggcagtcgtagtaaa
gtagcagtgtcttggttgggcaaggtcaaaaccacatcacaaatgttagcgctgggcggc
ttattatggcgttacaacatctatatggaagtagctgccattatcctactttatatcgca
gccattttaacaatttggtctatgctgcaatacttaattgcagctaaagatagcctgtta
gaagatttacgcaaataa

DBGET integrated database retrieval system