KEGG   Candidatus Koribacter versatilis: Acid345_1158Help
Entry
Acid345_1158      CDS       T00352                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00260  Glycine, serine and threonine metabolism
aba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aba01100  Metabolic pathways
aba01110  Biosynthesis of secondary metabolites
aba01130  Biosynthesis of antibiotics
aba01230  Biosynthesis of amino acids
Module
aba_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acid345_1158
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acid345_1158
Enzymes [BR:aba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acid345_1158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF3227 Gmad2
Motif
Other DBs
NCBI-ProteinID: ABF40161
UniProt: Q1ISI9
Position
1443750..1444976
Genome map
AA seq 408 aa AA seqDB search
MATKPIAKVRKSVPKKVESQVGYFGSYGGRFVPETLMAALQELEAAYEAAKRDKKFKEEI
ESLLREYAGRPTPLFLAKNLTQKLGGAKIYLKREDLLHTGAHKINNCIGQGLLARRMGKH
RIIAETGAGQHGVASATVAALFGMECVVYMGSEDVRRQELNVFRMKLLGAEVVSVNSGSR
TLKDAINEAMRDWVTNVRTTHYLLGSVLGAHPYPMMVRDFHRVISREAKAQIMKAEGKLP
TAIIACVGGGSNAIGAFYEFIGDKKVQLIGVEAGGRGKALGEHAARFRGGAPGVLQGTYS
YVLQDEHGQIAGTHSVSAGLDYPAIGPEHAALAEAGRAEYVAASDAEALAACSMLAKTEG
IIPALESSHAVAECVRRAPQMRKSDVVIVNISGRGDKDIGILREQLRF
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccaaaccaatcgcgaaagttcgtaagtcggtaccaaagaaagttgagtcgcag
gtcggctacttcggctcgtatggcggacgctttgtccccgagactctgatggccgcactc
caggagcttgaggctgcctacgaagcagccaagcgcgacaagaagttcaaggaagaaatc
gagtcgctgctgcgtgagtacgcgggacgtccgacgcccctgtttttggccaagaatctt
acgcagaaactgggcggggcgaagatttacctgaagcgcgaagaccttctccacacaggc
gcccacaagatcaacaactgtatcggtcaggggctgctcgcgcgccgcatgggcaagcac
cgcattatcgccgagacgggcgctggacagcatggagtcgccagcgcgacggttgccgca
cttttcggcatggagtgcgtggtttacatgggcagcgaggacgtccgacggcaggaactg
aacgtcttccggatgaagttgctcggggcagaagtcgtctccgtcaactccggttcgcgc
acactaaaggacgccatcaacgaagccatgcgcgattgggttacaaacgtccgcaccacg
cattacctgctgggcagtgtgctgggcgcacatccgtatccgatgatggtccgcgacttc
catcgcgtgattagccgcgaggccaaggcgcagatcatgaaggccgagggcaagctgccg
accgcgatcatcgcttgtgtgggcggaggatccaacgcgattggcgcgttctacgagttc
atcggcgacaaaaaggtccagctcatcggcgtggaggctggcggtcgcggcaaagcgctg
ggcgaacatgccgcacgcttccgcggtggagcaccaggcgtgcttcagggcacgtattct
tacgtccttcaggatgaacacggccagattgctggcacgcattcggtgtcggcgggattg
gattacccggcgattggtccggagcacgccgctcttgccgaagcgggacgcgccgagtat
gtagccgccagtgacgcagaagcgcttgcagcgtgcagtatgcttgctaagacggaaggc
attattccggcactggagtcgtcgcacgcggtggcggagtgtgttcgccgcgcgccgcag
atgcgtaagagtgacgtcgtcatcgtcaatatctcgggacgaggcgataaagacatcggt
attctccgagagcaacttcggttttag

DBGET integrated database retrieval system