KEGG   Candidatus Koribacter versatilis: Acid345_1267Help
Entry
Acid345_1267      CDS       T00352                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00330  Arginine and proline metabolism
aba00332  Carbapenem biosynthesis
aba01100  Metabolic pathways
aba01130  Biosynthesis of antibiotics
aba01230  Biosynthesis of amino acids
Module
aba_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Acid345_1267
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Acid345_1267
Enzymes [BR:aba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Acid345_1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Nic96
Motif
Other DBs
NCBI-ProteinID: ABF40269
UniProt: Q1IS81
Position
1538899..1539675
Genome map
AA seq 258 aa AA seqDB search
MRFVIKVGTSLIAPGGRIDTVLMRALVDQLDLERHEYLIVSSGAIASGMSKLAFSAKPKS
VRLMQACAAVGQSLLMYTYEQLFFGKKVVAQLLLSSDDFTSALRYENLQHALHELLKLGV
VPIVNENDSVSVRELVGAFGDNDELSALLATAVKADWLVLLTNVDGFYDSAGRGQKLVRT
VRRLTPKMEALCGEKSELGTGGMRSKLRAAMMASENGVQVAIANGTAPQAIRNAIERKIG
TYFPATKPAPKKRAKAAD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcgtcatcaaagtaggtaccagcctgatcgccccgggcggccgtattgatacg
gtgctcatgcgggcgctcgtcgaccagttggacctggagcggcacgaatacctcatcgtc
agctcgggcgcgatcgcttccggcatgtcgaaattggcattttctgcgaagccgaagagc
gtgaggctcatgcaagcgtgtgcagccgtgggacaaagcctgctgatgtatacctacgag
cagctcttcttcggcaaaaaagtcgtcgcacaactgctgctttcgagcgacgacttcacg
tcggctcttcgctacgagaatctgcaacacgcgttgcatgaattgctaaagcttggcgtg
gtaccgatcgtcaatgaaaacgatagtgtttccgtgcgcgaactcgttggtgctttcggg
gataacgacgagttgagcgcattgttggcgacggctgtgaaggccgactggctcgtgctt
ttgacgaacgtggatgggttctacgacagtgctggtcgcggacagaaactggtgcgcacg
gtgcggcgattgacgccgaagatggaagcgctctgcggcgaaaagagcgaactcggcacc
ggaggtatgcgatcaaagttacgcgcagccatgatggctagcgagaacggtgttcaggtt
gcaattgcaaacggcacggcaccgcaagcgattcgaaatgccatagagcggaagatcggt
acatattttccggcgacgaagcctgcccctaagaaacgcgcaaaggctgcggattaa

DBGET integrated database retrieval system