KEGG   Candidatus Koribacter versatilis: Acid345_1677Help
Entry
Acid345_1677      CDS       T00352                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00052  Galactose metabolism
aba00561  Glycerolipid metabolism
aba00600  Sphingolipid metabolism
aba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Acid345_1677
  Lipid metabolism
   00561 Glycerolipid metabolism
    Acid345_1677
   00600 Sphingolipid metabolism
    Acid345_1677
Enzymes [BR:aba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Acid345_1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Melibiase Melibiase_2_C Raffinose_syn Glyco_hydro_30C Glyco_hydro_97
Motif
Other DBs
NCBI-ProteinID: ABF40678
UniProt: Q1IR22
Position
complement(2028162..2029388)
Genome map
AA seq 408 aa AA seqDB search
MRRPGPQMKRFVASIPLVIIFLSIIAAAQESPKPPDINAYAPTPPMGWNTWNKFACNVDE
KLIRGAADALVSSGMKDAGYHYLVIDDCWQVSRDGKGNIVADPQRFPSGIKALAAYVHHK
GLKFGIYSDIGTKTCQGRPGSRGHEFQDALQYAAWDVDYLKLDWCNTGTQNAPASYKTMR
DAIDATGRPIVLSICEWGKSKPWLWAKDTGNLWRTTDDIQDRWAGKKKWDEASCCSNGML
DILDEEADIASYAGPGHWNDPDMLEVGNGGMTNVEYRSHFSLWAILAAPLMAGNDLTNMR
PEIREILTNKEVIAVDQDPLGKQGVRAAKNGDLEIWSKVLADGSRAAVLLNRSASEQEIT
ARWIDLGYPATLSVRVRDLWAHKDLGSFKDKFSAKVPSHGVVMIHLQP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
ttgcggaggcccggcccgcagatgaaacgcttcgtcgcatccatccctctcgtaataatt
tttcttagcatcattgctgccgcgcaagaatccccaaagccgccggacatcaacgcctac
gcgccaaccccgccgatgggatggaacacgtggaacaagttcgcctgcaatgttgacgag
aaactcattcgtggcgccgccgatgcactcgtctcctctggcatgaaagacgctggttac
cattacctcgtcattgacgactgctggcaagtcagccgcgacgggaaaggcaacatcgtt
gccgatccacaacgattcccttccggcatcaaggccctcgccgcgtacgtccaccacaaa
ggactgaaattcggtatctactccgacatcggcaccaagacttgccaaggccggcccgga
agccggggccatgaatttcaagacgccctgcaatacgccgcatgggatgtcgactatctc
aaactcgattggtgcaacactggcacccagaacgccccagcctcgtacaaaaccatgcgc
gatgcgattgatgccacgggccgtcccatcgttctaagcatctgcgaatggggcaagagc
aagccgtggctctgggccaaagacaccggtaatctctggcgcaccaccgacgacattcag
gatcgctgggccggcaagaaaaaatgggatgaagcctcatgctgctccaacggcatgctc
gacattctcgatgaagaagccgacatcgccagttacgccggtcccggacactggaacgat
cccgacatgctcgaggtcggcaacggcggcatgaccaacgtcgaatatcgttcccacttc
agcctatgggcaatcctcgctgcgcctctcatggccggcaacgatctcaccaacatgcgc
cccgaaattcgcgaaatcttgaccaacaaagaagtgatcgccgtagatcaagacccgctc
ggcaagcagggcgttcgcgcagcgaagaacggcgatctcgaaatctggagcaaagtgctt
gccgacggatctcgcgccgctgtcctcctcaaccgcagtgcatcggaacaagagatcacc
gcgcgatggatcgacctcggttatcccgcgacactctccgtgagggtccgagacctctgg
gcgcacaaagatctcggttctttcaaagacaagttttccgccaaagttccatcgcacggt
gtcgttatgattcacctgcaaccgtaa

DBGET integrated database retrieval system