KEGG   Candidatus Koribacter versatilis: Acid345_3680Help
Entry
Acid345_3680      CDS       T00352                                 

Definition
(GenBank) glutamate synthase (NADH) large subunit
  KO
K00265  glutamate synthase (NADPH) large chain [EC:1.4.1.13]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00250  Alanine, aspartate and glutamate metabolism
aba00910  Nitrogen metabolism
aba01100  Metabolic pathways
aba01110  Biosynthesis of secondary metabolites
aba01120  Microbial metabolism in diverse environments
aba01130  Biosynthesis of antibiotics
aba01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aba00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Acid345_3680
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acid345_3680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aba01002]
    Acid345_3680
Enzymes [BR:aba01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     Acid345_3680
Peptidases [BR:aba01002]
 Cysteine Peptidases
  Family C44
   Acid345_3680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_2 Glu_synthase Glu_syn_central GXGXG
Motif
Other DBs
NCBI-ProteinID: ABF42681
UniProt: Q1IKB9
Position
complement(4350906..4355513)
Genome map
AA seq 1535 aa AA seqDB search
MQSKESVNLNPQVKYSPGLPPAQGLYDPRHEHDACGMGFVASLRGEKSHAIIDKGLEILI
NLAHRGACGCDPETGDGAGITIQVPHTFFARECPLSGFSLPNPGEYAVGMVFLPVDTHPR
LQCEGILERIIREEGLTVLGWRDTPVDETAIGRVARGSQPYIEQIFVDRPAGMDEAAFER
KLYVVRKRTEREIAEHEEDWKEWFYIPSLSSRTIVYKGLLIAPQLSKFYPELADPDVTSS
LCLVHQRFSTNTFPSWQLAHPFRYVAHNGEINTLKGNASWMHARQSILESPLFGDDIKKL
FPIIPSGSSDSAAFDCALELLVQAGRSLPHAMAMLIPEAWTGNPHMKPEKRAFYEYHASL
MEPWDGPAAIAFTDGRLIGATLDRNGLRPGRYMVTEDDLVVLASETGVLDVPADRVKRKG
RLQPGKMFVVDTVAGRIVTDKEIKQSLSERQPYQEWLEKNQITLAQLPEPTRLHASDLST
LLRRQRAFGYTDEDLQMILEPMGNKGEEPIGSMGTDTPLACLSDRPQLLFSYFRQLFAQV
TNPPIDPIREEMVMSLTSYIGTERNILDETPLNCHTLKLPQPVLTNRDLEKLRRLSYGDL
LATTLSTGFRVKEGEEGLQRALDELCRRASLSVKSGYTLLILSDRGLDEQYAPIPSLLAL
AAIHNTLIREETRTQVALIVESGEPREVMHFALLIGYGASAVNPYLAIETLEERANSGYL
NDGVTAESAVKNFIKAINKGLLKTFSKMGISTLQSYRGAQCFEAIGLNGELIDAHFAGTV
SRIEGVGLEVIAREALLRHEFAFRAPRDFEAELSSGGQYHYRVDGEYHLLNPQTISKLQH
AVRSADAKTFQEYTDLIDSQNRELCTLRGLLKIKDSARPVPLEEVEPAKEIVKRFATGAM
SFGSISKEAHETLAIAMNRIGGKSNTGEGGEDESRFQRDENGELRRSAVKQVASARFGVT
TNYLVNADELQIKMAQGAKPGEGGQLPGHKVDEVIAKLRHSMPGVGLISPPPHHDIYSIE
DLAQLIYDLKNVNPQARISVKLVAEVGVGTVAAGVAKAHADVVLISGDSGGTGASPLSSI
KHAGIPWELGLAETQQTLLLNDLRSRIRVQTDGKLQTGRDVVIGALLGAEEFGFATTPLI
AMGCVMMRKCHLNTCSVGIATQDPVLRARFSGQPEHVINFFFFLAEQVRGFMAQMGFRTF
DEMVGRVDMLDARDATDHWKARGLDLSTVLYTPTLPGRVARRCVKAQDHGLQDALDYLLI
DRTRDAVERKVPIELAPLPIRNVHRTVGAMLSGDIARRYGSAGLDDETIRIHFQGSAGQS
FGAFLAKGVTLTLEGDANDYTGKGLSGGRIIIHPPKISPLIPEENIIVGNVVLYGATSGE
AFFSGVAGERFAVRNSGATAIVEGLGDHGCEYMTNGTVVVLGACGRNFAAGMSGGIAYVF
DERDDFTQKRCNTASVDLDPLETEDEEFLRRLISRHMVLTGSSRARWILQHWADTLPRFV
KVFPHEYKRVLRKVEAAPPLIVHQPTPVAAEVQHG
NT seq 4608 nt NT seq  +upstreamnt  +downstreamnt
ttgcagtcgaaggagagcgtgaacttgaatccccaggtaaagtactcccccggtctccct
cccgcgcaggggctctacgatccccgtcacgagcacgacgcttgcggcatgggcttcgtt
gcgagcctgcgcggcgaaaagagccacgccatcatcgacaagggccttgagatcctcatc
aacctcgcgcaccgcggcgcctgcggctgcgatcccgaaaccggcgacggcgccggcatc
accatccaggtcccgcatacattcttcgcgcgcgagtgcccgctctccggcttctcgctc
ccgaaccccggtgaatacgccgtaggaatggtatttctgcccgtcgacacgcatccccgc
ttgcaatgcgaaggaattctcgaacgcattattcgcgaggaaggcctcacggtcctcggc
tggcgcgatactcccgtggacgaaactgcgattggccgcgtcgcccgcggttcgcagccc
tacatcgagcaaatctttgtcgaccgtccagctgggatggacgaagctgccttcgagcgc
aagctctacgtcgttcgcaagcgcactgagcgcgagattgcagagcacgaagaggactgg
aaggaatggttctacattccgtcgctctcgtcgcgaacgatcgtttacaagggacttttg
atcgcgcctcagctctccaagttctatcccgagctggccgatcccgacgtcaccagctct
ctctgcctcgtccaccagcgcttttccacgaacacatttccgagctggcagctcgcgcac
ccgtttcgctacgtcgcgcacaatggcgaaatcaacacgctgaagggcaacgcgagctgg
atgcatgcccgccagtcgatcctcgaatcgccgcttttcggtgacgacattaaaaagctt
ttcccgattatcccgtccggttcgagcgactccgcggctttcgattgcgcgctcgaattg
ctcgtgcaagccggacgctcgttgccgcacgcgatggcaatgctcattcccgaggcgtgg
accggcaatccgcacatgaagcccgagaagcgcgcgttctacgagtaccacgcgtcgctg
atggaaccgtgggatggtccggcggcgattgccttcaccgacggccgtctcatcggcgct
acgctcgatcgcaatggcctgcgcccgggccgctacatggtcacggaagatgatctcgtt
gtgcttgcctccgaaactggcgtgctcgacgtgcccgccgatcgcgtgaaacgcaagggc
cgtcttcagcccggcaagatgttcgttgtggatacggtcgccggccgcatcgttaccgac
aaagaaatcaagcaatcactctctgagcggcagccctaccaggagtggctcgagaagaac
cagatcacgctcgcacaacttcctgagcccacccgccttcacgcttctgatctcagcacg
ctgctgcgtcgtcagcgcgcctttggatacaccgacgaggatctgcagatgatcctcgag
cccatgggcaacaagggcgaggagcccattggttccatgggtaccgacacgccgcttgcg
tgtctatcggatcgcccgcaactcctgttcagctacttccgtcaactcttcgcgcaagtc
accaatccgcccatcgatcccattcgcgaagagatggtcatgtcgctcaccagctacatc
ggtactgagcgcaacattctcgacgagacgccgctcaactgccacacgctgaaactgccg
cagcccgtgcttaccaatcgcgaccttgagaagctgcggcgtctgtcgtatggcgatctt
ctcgcgacgactctctccaccggattccgcgtgaaggaaggcgaagagggcttgcagcgc
gcgctcgacgaactctgtcgtcgcgcatccctgtcggtgaagtccggctacacgctgctc
atcctttccgaccgtgggctcgacgagcagtacgcgccgatcccgagcttgctcgctctc
gcggccattcacaacactctgatccgcgaggaaacgcgcacccaggttgcgttgattgtc
gagtccggcgagccgcgcgaagtcatgcatttcgcattgttgatcggctacggcgccagc
gcggtcaatccgtatctcgccatcgaaacgctggaagagcgcgccaattccggctatctc
aacgacggcgtcactgctgagtctgcggtgaagaacttcatcaaggccataaacaaaggc
ctgcttaagaccttctcgaagatgggcatctccacactgcaaagctatcgcggagcgcag
tgctttgaggccatcggtctcaacggcgaactgatcgacgctcacttcgccgggactgtc
tctcgcattgaaggcgttggcctcgaggtgatcgcgcgcgaagctctactgcgtcacgag
ttcgcattccgtgcaccgcgcgatttcgaagcggagctgtcgtcaggcggtcaatatcac
taccgcgtcgatggcgaataccacctgctcaatccgcagacgatcagcaagcttcagcac
gccgtccgctccgccgatgccaagaccttccaggagtacaccgacctcatcgacagccag
aaccgcgaactctgcaccctgcgcgggttgctgaaaatcaaggactctgctcgcccagtt
ccgctcgaagaagtcgaacccgcgaaagagatcgtgaagcgcttcgctaccggtgcgatg
tcgttcggctccatcagcaaggaagcccacgagacgctcgccatcgccatgaaccgcatc
ggcggcaagtccaatacgggcgagggcggggaagacgagtctcgcttccagcgcgatgaa
aacggagaactccgccgcagcgcggtgaagcaagtcgcctccgcgcgcttcggtgtaacc
acgaactacctcgtcaacgccgacgaactgcagatcaagatggcgcagggcgccaagccc
ggcgagggcggccagctgcccggccacaaggtggacgaagtcatcgccaagctgcgccac
tccatgcccggcgtcggactgatctcgccaccaccgcatcacgacatctactcgatcgaa
gatctcgcacagctcatctacgacctgaagaacgtcaacccgcaggcgcgtatctcggta
aagctcgttgctgaagttggcgtcggcacggtcgctgccggagtcgcgaaagcacatgcc
gatgtagtcctaatttccggcgacagcggcggaactggcgcttcgccgctcagttcgatc
aagcacgccggcattccctgggagcttggcctcgccgaaacacagcagacgctgctcctc
aacgaccttcgcagtcgcatccgtgttcaaaccgatggcaaacttcaaaccggccgcgat
gtcgtaatcggcgcgcttctcggagcggaagaattcggcttcgcaaccacgccgctcatc
gccatgggctgcgtgatgatgcgcaagtgccacctcaacacgtgctccgtcggcatcgcc
acgcaggatccggtgctgcgcgcgcgcttcagcggtcagcccgagcacgtgatcaatttc
ttcttcttcctcgccgagcaagtccgcggcttcatggcccagatgggtttccgcaccttt
gacgaaatggtcggccgcgttgacatgcttgacgcgcgtgacgctaccgaccactggaag
gcccgcggcctcgatctctcaaccgttctctataccccgacgcttccgggccgtgtcgcg
cgccgctgcgtgaaggcgcaggatcacggcctgcaagacgcgctcgactacctgctcatc
gatcgcacccgcgacgcggtcgaacgcaaagtaccgatcgaactcgctccgcttccgatt
cgcaacgtgcatcgcactgtcggcgccatgttgagtggcgacatcgcccgccgctacggt
tcggctgggctcgatgacgaaaccatccgcattcactttcaaggctctgcgggccagagc
ttcggtgcgttcctcgctaaaggcgtaaccctcacgcttgaaggcgatgccaacgattac
accggcaaaggcctttccggtggacgcatcatcattcatccgccaaagatttcgccgctg
attccggaagagaacatcatcgttggcaacgtcgttctttacggcgcgacgagcggagaa
gccttcttctcaggcgtcgccggcgaacgctttgcggttcgcaactctggggcgactgcg
atcgtcgaaggcctcggcgatcacggctgcgagtacatgaccaacggcactgtcgtcgtc
ctcggtgcctgcggacgcaacttcgccgcgggcatgagtggcggcatcgcctacgtcttc
gacgagcgcgacgactttacacagaaacgttgcaacaccgcgtctgttgatctcgatccc
ctcgaaaccgaagacgaagaattccttcgccgcttgatctcaagacacatggtgctcacc
ggcagctcccgcgcgcgctggatcctccagcactgggccgacacgctgccgcgcttcgtg
aaggttttcccacacgaatacaagcgcgtattgcgcaaggtcgaagccgcgcctccattg
atcgttcaccagccaacgccggtagccgcggaggtgcagcatgggtaa

DBGET integrated database retrieval system