KEGG   Candidatus Koribacter versatilis: Acid345_3685Help
Entry
Acid345_3685      CDS       T00352                                 

Definition
(GenBank) imidazoleglycerol-phosphate dehydratase
  KO
K01693  imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00340  Histidine metabolism
aba01100  Metabolic pathways
aba01110  Biosynthesis of secondary metabolites
aba01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Acid345_3685
Enzymes [BR:aba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     Acid345_3685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD
Motif
Other DBs
NCBI-ProteinID: ABF42686
UniProt: Q1IKB4
Position
4359442..4360029
Genome map
AA seq 195 aa AA seqDB search
MRKATLDRNTAETKIHLELHVDGKGKYEISTGIRFFDHMLELFTRHGAFDVTLRCEGDLD
VDQHHTVEDVGIALGQAFTQALGSKMGILRAGYFVMPMDETLAVAAVDLSGRSAYAVDTK
VKVRIVGDLQTELVDDFFEGFSRGALANVHIKVMYGRSNHHKIEASFKAFARALRFACAK
DKRLAKVLPSTKGLL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggcaacgctcgaccggaataccgccgaaaccaagatccacctggaattgcac
gtggacggcaagggcaagtatgagatttcgacgggcatccggttctttgatcacatgctc
gagctcttcacgcggcatggcgcgttcgatgtaacgctgcgatgcgagggcgacctcgac
gtcgaccagcatcacaccgtggaagatgtggggatcgcattggggcaggcgttcacgcag
gctctcggcagcaagatgggtatcctgcgcgccggatatttcgtgatgcccatggacgag
acgctggctgtggccgccgtggacttaagtggacgaagcgcatatgcggtggacacaaaa
gtaaaagtcaggattgtaggcgacttgcagacggagttggtcgacgacttcttcgaagga
ttcagccgcggagcgctggcgaatgtacacatcaaggtgatgtacgggcgttcgaaccat
cacaagattgaagcttcgttcaaggcatttgcgcgagcgctgcggttcgcatgcgccaaa
gacaagaggctggcaaaagtgctgccgagcacgaagggactgttgtga

DBGET integrated database retrieval system