KEGG   Candidatus Koribacter versatilis: Acid345_3686Help
Entry
Acid345_3686      CDS       T00352                                 

Definition
(GenBank) imidazole glycerol phosphate synthase subunit hisH
  KO
K02501  glutamine amidotransferase [EC:2.4.2.-]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00340  Histidine metabolism
aba01100  Metabolic pathways
aba01110  Biosynthesis of secondary metabolites
aba01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Acid345_3686
Enzymes [BR:aba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     Acid345_3686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase SNO GATase_3 Peptidase_C26 DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ABF42687
UniProt: Q1IKB3
Position
4360026..4360622
Genome map
AA seq 198 aa AA seqDB search
MIAIVDYGAGNLTSVAKALRHLGALVEITADPIAVAAADAVVLPGVGHFASTQTIGQQGL
TPAIRDAIASDKPFLGICVGLQWVFAGSAEAPETAGLGCFDATCERFPAGARVPHVGWNQ
LEITRPSRLLEGVRNDAHVYYTHSYFAPVVPETVATTEYGCDFTAVVERGNTFAVQFHPE
KSGENGLTILRNFVRLAC
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcaattgttgattacggcgccggcaatctgacttcagtggccaaggcattgcgg
catcttggagcactggttgagattactgccgatccgatcgccgtggccgcagccgatgcc
gtagttctgccgggcgtaggccacttcgcgtcgacgcagacgatcggccagcaaggactg
acgccggcgattcgcgatgcgatcgcgagcgacaagccgtttcttggaatctgcgtggga
ctgcagtgggttttcgcggggagtgcagaggcgccggaaactgcgggactcggttgtttt
gatgccacgtgcgagcgtttccccgcaggagcgcgggtgccgcatgtgggctggaaccaa
cttgagatcactaggccgtcgcgcttactggaaggcgttcggaatgacgctcacgtttac
tacacacattcttacttcgccccggtggttccggagactgtcgcgacgacggagtatggc
tgcgatttcaccgcagtcgtggagagagggaataccttcgcggtgcagtttcatccggaa
aaatctggcgagaacgggctcacgatccttcgcaatttcgtgaggctcgcatgctga

DBGET integrated database retrieval system