KEGG   Candidatus Koribacter versatilis: Acid345_3687Help
Entry
Acid345_3687      CDS       T00352                                 

Definition
(GenBank) imidazole glycerol phosphate synthase subunit hisF
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00340  Histidine metabolism
aba01100  Metabolic pathways
aba01110  Biosynthesis of secondary metabolites
aba01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Acid345_3687
Enzymes [BR:aba01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     Acid345_3687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth TMP-TENI ThiG NMO DHO_dh Dus
Motif
Other DBs
NCBI-ProteinID: ABF42688
UniProt: Q1IKB2
Position
4360616..4361377
Genome map
AA seq 253 aa AA seqDB search
MLKRRIIACLDVRDGRVVKGVNFVNLRDAGSPAEMAGAHAKAGADEIVLLDITATYEGRG
TLLETVRKTAAELFIPFTVGGGIRTLDDARAVFDCGADKLAINSAAIADPDLITKIAARF
GSQAVVLAIDARRTGSRWEVFKTGGRTGTGLDAEQWAAEGEKRGAGEILLTSMDCDGTQT
GFDCELTAAIASRVSIPVIASGGAGTAEHFVDVFQRGHADAALAASIFHFGVHDVNELKR
TLSAAGIPVRLEC
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcgacggatcatcgcttgtctcgacgtgcgtgatgggcgcgtggtgaagggc
gtgaatttcgtaaatcttcgcgatgctggatctccagcggaaatggccggcgcccacgcc
aaggctggggcagatgagatcgtcctgctcgacatcacggcgacctacgaaggccgcggc
acgctgctcgaaaccgtccgcaagaccgcggcagagttgttcattccattcacggtgggc
ggaggaattcgaactctcgacgacgcgcgtgcggtgttcgactgcggagccgacaagctc
gcgattaattcagcagctatcgccgatcccgacttaatcacgaagatcgcggcacgattt
ggatcgcaagcagtggtgctggcgattgacgcgagacgtaccggctcgcggtgggaagtc
ttcaagaccggcgggcgcacgggaactgggctggacgcggagcaatgggcagccgagggc
gagaagcggggcgcaggcgagatattgctgacatccatggattgcgatggcacgcagact
ggcttcgactgcgaattgaccgcggcgattgcatcgcgcgtctcgatcccggtaatcgcg
tcgggcggcgccggcacggcagagcactttgtagacgtatttcaacgaggacacgcggat
gctgcgctggctgcgtcgatcttccattttggcgtgcatgatgtgaatgagctgaaacgc
acactgtcggctgcgggaattcctgtgaggctcgaatgctaa

DBGET integrated database retrieval system