KEGG   Candidatus Koribacter versatilis: Acid345_3688Help
Entry
Acid345_3688      CDS       T00352                                 

Definition
(GenBank) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
  KO
K01814  phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00340  Histidine metabolism
aba01100  Metabolic pathways
aba01110  Biosynthesis of secondary metabolites
aba01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Acid345_3688
Enzymes [BR:aba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     Acid345_3688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth PcrB Trp_syntA G3P_antiterm
Motif
Other DBs
NCBI-ProteinID: ABF42689
UniProt: Q1IKB1
Position
4361371..4362057
Genome map
AA seq 228 aa AA seqDB search
MLIPSIDLMGGKIVQLVQGEKKAFETTDFDAWCERFAGFPMVQLIDLDAAKRQGDNRELI
ANIVLRLPCQVGGGVRDADVAERLLAIGAKRVIVGSSYIRDGRVDVDFARGLAERCGTDR
VIAAIDSREGFVAVRGWQESVPITAGEMIAALTPYVGGFLYTHVDTEGLLVGFPTDIARR
LRTLTEKQLIAAGGIRSQEEIDELDGIGVDAVVGMAIYTGKLVVKGNS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctaatcccctcgatcgatctcatgggcgggaagattgtgcaactcgtccagggagag
aagaaggcctttgagaccaccgatttcgatgcgtggtgtgagcgcttcgcaggatttccg
atggtccagctcatcgacctcgacgcagcaaagaggcaaggcgataaccgcgaactcatc
gcgaatatcgttttgcgacttccctgccaagtcggcggcggagtgcgagatgccgacgtc
gccgagcgactgttggcgattggagcgaagcgggtgatcgttggctcatcgtatatacgg
gacggccgtgttgatgtggacttcgcgcgaggcctggcagagcgctgcggcacggatcgc
gtcatcgccgccatcgactcgcgagaaggcttcgttgcggtgcgtgggtggcaggagtcg
gtgccgatcactgctggcgaaatgattgcagcgctcactccctacgtgggcgggttcctc
tacacgcacgtggacaccgaaggactattggtaggatttccaactgacattgctcgacgt
ctgcgcacgctcaccgagaagcaattgattgcggccggaggtattcgttcgcaagaagag
attgatgaactcgacggaattggggtggatgctgtcgttgggatggcgatttatacgggc
aaactcgtggtgaaggggaattcttaa

DBGET integrated database retrieval system