KEGG   Candidatus Koribacter versatilis: Acid345_3691Help
Entry
Acid345_3691      CDS       T00352                                 

Definition
(GenBank) hypothetical protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF481
Motif
Other DBs
NCBI-ProteinID: ABF42692
UniProt: Q1IKA8
Position
4366674..4367765
Genome map
AA seq 363 aa AA seqDB search
MTCSRLQSSLALLGFVLLTLPLFAADPDMVTFVNGESMSGQLVKVTDGKVFFHSDMVGDV
SFDWDKVKDLKTTKPFAVVPKGAKIGKHGEGTSEGTIAVSDNKLSVASTTVPTGDAAFVV
DQPTFEKQMHHNGFLTGWVGAITAGVSLVRATQDNTNFTSSFTFQRRSPTAEWMTTRSRT
LIDFTNVYGKVTQAGTPDVKTSIYHADGEQDEYFSERFYALGHASFDHNFSQGLDLQQLY
GGGLGFTVLKTKIHELDFKGDLHYEKQQFDVASSNQNLIGSEFVESYIRKLAHGMVFTEG
VLYDAAWNNTTAYSAQGTIGLAAPFSKRFSLSINLLDGYINNPPPAFKKNSLQFTTGLTY
TVK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacgtgctcacggttgcagtcctcgctcgcgctgctcggtttcgttctgctcactctt
ccattgttcgccgcagatccggatatggtgacctttgtcaacggggagtcgatgtcgggt
cagttagtaaaagtgactgacggaaaagtcttcttccacagtgacatggtgggagatgtg
tcgttcgactgggacaaggtcaaagacctaaagacgacgaagccgttcgcggttgtaccc
aagggcgcgaagatcggaaaacacggcgaaggcacttccgagggcacgatcgcagtcagc
gacaacaagctctcggttgccagcacgacggtaccgactggcgatgctgcgttcgtggtc
gatcagcccacattcgagaagcaaatgcaccataacggcttcctgaccgggtgggtcggc
gcgatcaccgcgggagtttcgctggtgagagctactcaggacaacacgaacttcaccagt
tcgttcaccttccagcgacgcagcccaactgccgagtggatgacaacgagatcgcgaacg
ctgattgacttcaccaacgtctacggcaaggtgacgcaagccggaacgccggatgtgaaa
acgagcatctaccacgccgatggcgaacaggacgagtacttcagcgagcgtttctatgcg
ctaggccacgcctccttcgaccacaatttctcgcagggtcttgatttgcagcagttgtac
ggtggcggtctgggattcaccgtgctcaagacaaagatccacgagttggatttcaaaggc
gacctgcattacgagaagcagcagttcgacgttgcatcgagcaaccagaatttgattgga
tccgagtttgtcgagagctacatacgaaagctggcgcacggaatggtcttcacggaaggc
gttctgtatgacgctgcctggaacaataccaccgcatattccgcccaaggcaccatcggt
cttgcagccccattttcaaagcgcttcagcctgtcgatcaatttgctcgatggatatatc
aataacccgccgccggcgttcaagaagaactcgctccagttcaccacgggcctgacgtac
acggtgaaatga

DBGET integrated database retrieval system