KEGG   Candidatus Koribacter versatilis: Acid345_3694Help
Entry
Acid345_3694      CDS       T00352                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00564  Glycerophospholipid metabolism
aba01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aba00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Acid345_3694
Enzymes [BR:aba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Acid345_3694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 GIDA NAD_binding_8 Pyr_redox_2 HI0933_like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABF42695
UniProt: Q1IKA5
Position
complement(4369657..4371309)
Genome map
AA seq 550 aa AA seqDB search
MVFAHLTLCMGVSTCVRAPIPAKRFDVVVIGGGIVGVAIARTTALAGKSTLLLEQHDFAS
GATCRGPRIVGDVFSDLERGDFAIARETLRERDRLLVERPHLVRPMTGIIALGAESRRSK
LEVRFGLWLRRRLGNASQWRPNDAEIDLAKQALGPQRAASVFAFDDATCDFPERLVAEWL
REAVAAGAIARNYCRALEVVVKDGTAVGVRTRDLCTDMEQEINAEWVVNATGPFAEQFCS
DSHIETPRTIAPLRAIHLALQRFPAAPEATIHFEGVDGNEVMLSPWNGQLLLSAVRPNSN
ALPFAGPSEAEQDYLRLSLNSILPGVEIRVNTAFAAPVAAFGEGALESPGERNRSLVLNH
PGTGKFLTVISGSLTASAFAVAECGRQLGLRTRPDSECVYLPGRGNGIEATLQHWAHAVA
SSSRIPERVARSIAAWHGRGALCIARLAAGNAELRTTLCPHTDHIVAEAIDAVRYEGALT
LADILMRRLPVALSSCWSEECTRTAAQRIGKWMNWSAAQNDLQVECVEAERAAFLVKPGP
LRDLSDQLAA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
ttggtgtttgcacatctcacgttgtgtatgggcgtgagtacctgcgtgcgcgctccgatt
ccggccaagcgctttgacgtggtcgtaatcggcggcggaatcgtcggcgtggcaattgcg
cgaacaaccgctctcgcagggaagtccacgcttctcctcgaacaacacgatttcgcgtca
ggcgctacctgccgcggtcctcgtatagtgggtgacgtcttttccgaccttgagcgcggc
gactttgcgatcgcgcgcgagacgctccgtgagcgcgatcgcttgctggttgagcgcccg
cacctggtgcggccaatgacgggaatcattgcgctcggggctgagagcagacgcagcaaa
ctcgaggttcggttcgggctttggcttcgtcgccgactcggaaacgcctcgcaatggagg
ccgaatgacgctgaaatcgatcttgcgaaacaggccctcggcccacaaagggcggcgtcc
gttttcgcgttcgacgatgctacgtgcgacttcccggagcgcttagttgcggagtggctg
cgagaggccgtggccgccggcgccatcgctcgtaattactgccgcgctctcgaggtcgtg
gtcaaggatggaacggctgttggtgtgaggacacgcgacctctgcaccgatatggaacag
gagatcaatgctgagtgggtcgtgaatgccaccgggcccttcgccgaacagttttgcagc
gactcgcacatcgaaacgccacggacgattgcaccacttcgcgcgatccatttggctttg
cagaggtttcccgccgcgccggaagccaccatccatttcgaaggtgtggacggcaatgaa
gtgatgctgagtccgtggaacggccagctgcttttgagcgccgtgcggcccaatagcaac
gcgttgccgtttgccgggccttccgaggcagagcaggattatcttcgtctttctctcaac
tcgattctccccggtgtcgagatccgggtgaacactgccttcgcggcgcctgtcgcggct
ttcggagagggagcccttgaatctcccggcgaacgcaatcgcagtctggttctaaaccac
cctggaacaggaaaattcctcaccgtaatcagtggctctctcacggcctcggccttcgcg
gtcgccgaatgtggtcgccagcttggattgcggacgcgacctgattccgaatgtgtgtat
ctgccgggacgtggaaatgggatcgaggctacgcttcagcactgggcccacgcggtcgct
agttcctctcgcatacccgagcgcgttgcgcgaagcattgctgcatggcatgggcgaggc
gctttatgcatcgctcgtctcgcggccggcaatgcagagctgcgtacgacgctgtgcccg
cacaccgaccacatcgtggccgaggccattgacgctgtacggtacgaaggcgctctgaca
ctcgcagacattcttatgcgaaggctgccggtggcgctgtcatcgtgctggtctgaggaa
tgtacccgcactgccgcccagcggatcggaaaatggatgaactggagcgccgctcagaac
gatctccaagtggaatgcgtggaagcggagcgcgctgcctttctcgtgaaaccggggccc
ttgcgcgatctgagcgaccagttggccgcatag

DBGET integrated database retrieval system