KEGG   Candidatus Koribacter versatilis: Acid345_3697Help
Entry
Acid345_3697      CDS       T00352                                 

Definition
(GenBank) electron transfer flavoprotein beta-subunit
  KO
K03521  electron transfer flavoprotein beta subunit
Organism
aba  Candidatus Koribacter versatilis
Brite
KEGG Orthology (KO) [BR:aba00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Acid345_3697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ETF Usp
Motif
Other DBs
NCBI-ProteinID: ABF42698
UniProt: Q1IKA2
Position
4372831..4373601
Genome map
AA seq 256 aa AA seqDB search
MKILVCMKQVPQKDAPLKLNESGTWIREDVSYEVNEPDAYALEEALRQKEKNGGEVVVIT
SGPARAQQVLREALAKGADRAIHLEDDKFVGLDAYNTARAISAAVKDENFDLVFTGLQSD
DYGYAQTGVILAELLGAPHATIIMHIEKKDAGIRVKRELESGYFQYVDMPLPAVLTIQSG
INKLRYATLIGIKQAKNKPLRKVSYAEVESALGQNLQKIEKLYIPQKTKQTEKIEGSPAE
IAKKLVDKLKNEIRVL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcctggtctgcatgaagcaggtaccgcagaaagatgccccgctgaagctcaat
gagtcgggtacctggatccgtgaagatgtttcgtacgaagtcaacgagccagatgcttac
gcgctcgaagaggcacttcgtcaaaaggagaaaaacggcggcgaagttgtcgtaatcacc
tccggtccggcgcgtgcccagcaggtgctgcgcgaagcgctggccaagggtgcggaccgc
gccattcacctcgaagacgacaaatttgtcggcctcgacgcctacaacaccgcgcgtgcg
atctccgcagcagtcaaggacgagaattttgaccttgtctttactggcctgcaatccgac
gactatggctacgcgcagactggcgtgatcctcgcggaacttttgggcgcgccccatgcc
acgatcatcatgcacatcgagaagaaagatgccggtattcgtgtgaaacgcgaactggaa
agcggatacttccagtatgtggacatgccgcttcccgcggtgctgaccatccagtcgggc
attaacaagctgcgttatgcgacgctgatcggcatcaagcaggcgaagaacaagccgctg
aggaaagtttcgtacgccgaggtcgagagcgcactcggccagaacctgcagaagatcgaa
aaactttatattccccagaaaacgaaacagaccgaaaagatcgaaggatcgccggccgaa
atcgcgaaaaagctggtggacaagctgaagaacgaaattcgcgttttgtaa

DBGET integrated database retrieval system