KEGG   Candidatus Koribacter versatilis: Acid345_3698Help
Entry
Acid345_3698      CDS       T00352                                 

Definition
(GenBank) hypothetical protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABF42699
UniProt: Q1IKA1
Position
4373662..4373928
Genome map
AA seq 88 aa AA seqDB search
MGFDVAHETKFQENRQLGSDLLMIGWVLLGMCGIGGIFVFQDIREGTSMWLIWNGVFGFL
GLALVAIGTFFRHRVPPASKNIPSNRAM
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
ttgggctttgatgtagcgcatgaaaccaagtttcaggagaaccgtcagctcggttcggac
ctgttgatgatcggttgggtattgctgggcatgtgcggaattggcggaatcttcgtattc
caggacatccgcgaaggcaccagcatgtggcttatttggaatggagtcttcggattcctc
ggtttggcgctcgtagcgattggcacgtttttcagacaccgtgtcccccccgctagcaaa
aacataccgtcaaaccgagcgatgtaa

DBGET integrated database retrieval system