KEGG   Candidatus Koribacter versatilis: Acid345_3703Help
Entry
Acid345_3703      CDS       T00352                                 

Definition
(GenBank) hypothetical protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABF42704
UniProt: Q1IK96
Position
complement(4377914..4378165)
Genome map
AA seq 83 aa AA seqDB search
MPQVSFSADIKPLFRAIDIAHMKPFGVELDDYAYMSNPDNANRVFATLSPHDGEPPTMPP
GGPYWTAAQLGLFMQWQSDGYKA
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagtttccttctcggcggatatcaaaccgttgtttcgcgccattgacattgca
cacatgaaaccgttcggcgtggaactcgacgattacgcttacatgtcgaatccggacaac
gcaaacagagtgtttgcgacgctctcgccgcacgatggcgagcctcccaccatgcctccg
ggtgggccgtattggacagcggcccaactcggattgttcatgcagtggcagagcgacgga
tacaaggcgtga

DBGET integrated database retrieval system