KEGG   Candidatus Koribacter versatilis: Acid345_3706Help
Entry
Acid345_3706      CDS       T00352                                 

Definition
(GenBank) conserved hypothetical protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_P460
Motif
Other DBs
NCBI-ProteinID: ABF42707
UniProt: Q1IK93
Position
complement(4379715..4380377)
Genome map
AA seq 220 aa AA seqDB search
MQKYLLWIYIFTVGLFIAGAFMVPAKPVAAQAKNASSKQSSVVFNADGTVNVPDPHVYRR
WVFVGAPLTPEALNNGKFNCDEPGGCTKSNFPEYHHVYIEQKNVDAYLKTGEFPEGTVIV
KELTRVLDPKFPDGSRKEPSGRGYFNGAFNGIDMSVKDSKRFAKTNGWGFFTFGHHPLPY
NKTSAERPATECAGCHLANVADTDMTWIQFYPLLLDKDPK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagtatttgttgtggatatacatcttcacagttgggctgttcatcgcaggcgct
ttcatggtgcccgcgaaaccggttgctgcccaggctaagaacgccagtagtaagcagtcg
agcgtggtctttaacgctgatggcaccgtgaatgtaccagatccccacgtttaccgcagg
tgggtctttgtcggcgctcccctgactcccgaggccctcaataatggcaagttcaactgc
gacgagcccggcggttgtaccaaatcgaacttccccgagtatcaccatgtctatatcgaa
cagaaaaatgtcgatgcatatctgaaaacaggcgaatttccggaaggaacggtcattgta
aaggaactcacccgggttcttgacccaaagttcccagatggttctcggaaggaaccttcc
ggacgtggatacttcaacggcgccttcaacggcatcgacatgtctgtcaaagacagtaag
cggttcgcaaagacgaacggctggggcttcttcacatttgggcatcatccgttgccatat
aacaagacctccgcggaaaggcctgcgactgagtgtgcggggtgccacctcgccaatgtc
gcggacacagacatgacttggattcagttctacccattgcttctggataaggatccaaag
taa

DBGET integrated database retrieval system