KEGG   Candidatus Koribacter versatilis: Acid345_3718Help
Entry
Acid345_3718      CDS       T00352                                 

Definition
(GenBank) protein of unknown function DUF417
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF417 DoxX_2 PrgI OAD_gamma
Motif
Other DBs
NCBI-ProteinID: ABF42719
UniProt: Q1IK81
Position
complement(4396104..4396664)
Genome map
AA seq 186 aa AA seqDB search
MKNTSTETTNVWAGIIARIDPIGHAFLRYGLAVVIGWIAAMKVTEYEAKGIQPLIAHSPF
LGWGYSIWTVRQLAMIIGAIELAIAALIAIRRWFPKLSAIGSVGAVFMFLITLSFIITTP
GWEPSLGGFPALSAGIGEFLIKDLVLLGASLWTLTDSLTAVSFQPDIDVEPLKKQERDTV
LPHRVH
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatacatctactgaaacaacgaatgtgtgggcaggcatcatagcgcgaatcgat
ccaatcggacatgcgtttctgcgctacggtttggcggtcgtaattggttggatcgcagcg
atgaaggtcacggaatacgaggcgaaaggcattcaacctctcattgcgcatagtccattt
ctgggctggggctacagcatttggactgtgcgtcagctcgcgatgataataggcgccatc
gagctcgccatcgctgcgttgattgcgattcgtcgctggtttccgaagctatctgctatc
ggaagtgtaggcgcggtgttcatgtttctgatcacgttgtcattcatcatcacaactcca
ggttgggagccaagcctcggcggttttcctgcgctttcagctggtataggagagtttctg
ataaaagacctggttttgctcggagcctcgctatggacactgacggactcgctcactgcc
gtctcctttcagcccgacatcgacgtcgaaccactcaagaaacaggaacgagatactgtc
ttgcctcatcgcgtccactga

DBGET integrated database retrieval system