KEGG   Candidatus Koribacter versatilis: Acid345_3721Help
Entry
Acid345_3721      CDS       T00352                                 

Definition
(GenBank) Alpha/beta hydrolase
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr
Motif
Other DBs
NCBI-ProteinID: ABF42722
UniProt: Q1IK78
Position
complement(4398381..4399301)
Genome map
AA seq 306 aa AA seqDB search
MSNTVTPSVWYRTLNVEGLEVFYREAGPRDAPTALLLHGFPSSSHMFRNLIPMLADKYHV
VAPDFPGYGESSAPPVNEFDYSFESFATITEKFTEKLNLSSYILYLSDIGASVGFHLAVR
HPERVMAMIVQNADAHVEAINKAFLKTGLSDYWEDRSERSAQLLLDWLLTIEGTKWHYLH
GVKDPSKISPDNWVIDQAYLDRPGNKSIQLSLLYNAKRNLDAYAGWQEYFRKHQPPMLIT
WGKNDGIFTVEGAELYKRDIPSAELHLIDTGHFALEEEVDRIGSLIHEFLDRKINNFGNA
ASTLVA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacacggttacaccatccgtttggtatcgcacccttaacgtggagggactggag
gtcttctatcgcgaagcgggtccgcgagatgctcccaccgctttactgttacacggcttt
ccgtcgtcttctcatatgttccgcaatctgattcccatgcttgcggataaatatcatgtt
gtcgccccagattttcctggatatggcgagagttcagcaccgccggtcaacgagttcgac
tactcctttgagagcttcgcgactatcaccgaaaagtttacggaaaagctgaacctttct
tcctatatcctctacctctcggacataggtgcatcggttggattccatttagctgtcagg
catccagaacgtgtgatggctatgatcgtccaaaacgctgacgcccatgttgaagcgatc
aataaggcgttcttgaagacgggattatctgattattgggaagaccggagcgagaggagc
gctcaacttctactcgattggcttctgacgatcgaaggaaccaagtggcattatctgcac
ggagtcaaggatccctcgaagatcagccccgataattgggtgatcgaccaggcttatctc
gaccgaccggggaacaagagtatccaactttcactcctctacaacgcaaaaaggaatctg
gatgcctatgcaggttggcaggagtatttccgtaagcatcagcctccaatgctgatcact
tgggggaagaacgacgggatctttacggtggaaggtgctgaactctacaaaagggatatc
ccaagcgcagagctgcatctgatcgacacgggtcatttcgcgctggaagaagaagtggat
cggattgggtcgttgatccatgagtttctcgatcgaaaaatcaacaacttcggcaatgcc
gcttcgacgcttgttgcctga

DBGET integrated database retrieval system