KEGG   Candidatus Koribacter versatilis: Acid345_3726Help
Entry
Acid345_3726      CDS       T00352                                 

Definition
(GenBank) Oxidoreductase FAD-binding region
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NMU
Motif
Other DBs
NCBI-ProteinID: ABF42727
UniProt: Q1IK73
Position
4403139..4403870
Genome map
AA seq 243 aa AA seqDB search
MWRVGTVVALRDETQTAKTITLRVVDWPNHVAGQHVDVRLTATDGYSAVRSYSIASAPNA
EGRVELTVEQLPEGEVSPYLTQELAIGDHIELRGPIGGWFIWRPRQTEPIQLIAGGSGIV
PLMAMIRSRASTGSTVPFRLLYSVREPGAVYYRNELQAISSRDDWLTTTHAYTRAAPKDW
LRPPGRVDTSLIANVTWPSSQTPTCYVCGPTAFVESIAAMLVSCGNHPDKIKTERFGPTG
GLK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgtgggaacggtcgttgctcttcgcgacgaaacgcagacagcaaagacgatc
acgctccgggtagtggattggcctaaccatgtcgcaggtcagcacgttgacgtgcgtctg
acggcaaccgatggatattccgcagttcgatcgtactcgatcgcgtcggctccaaatgcg
gaagggcgagttgaactgaccgtcgagcaactgcccgagggcgaggtttcaccctacctc
acgcaagagctagcaatcggagatcatattgaactcagaggtccgatcggcggttggttt
atttggcgaccgcggcaaacggagccgatccaattgatcgcgggtggttcgggaatcgtt
ccgcttatggcgatgattcgctctcgcgcatcgacagggagcaccgtaccctttcgtttg
ctgtattccgtgcgggagcccggagccgtctactaccgtaatgaactgcaggccatatcg
agccgggacgattggttaaccactacgcacgcatatacacgggccgctccgaaagactgg
ttgagacctcccggccgggtcgatacgtctcttatcgcaaacgtaacttggccttccagc
cagaccccaacgtgctacgtgtgcggtcccacagcattcgtagaaagtattgccgcaatg
cttgtgagttgcggcaatcatcccgacaagatcaagaccgagcgtttcggcccgacagga
ggtctcaaatga

DBGET integrated database retrieval system