KEGG   Candidatus Koribacter versatilis: Acid345_3728Help
Entry
Acid345_3728      CDS       T00352                                 

Definition
(GenBank) response regulator receiver protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg FleQ
Motif
Other DBs
NCBI-ProteinID: ABF42729
UniProt: Q1IK71
Position
complement(4405371..4405724)
Genome map
AA seq 117 aa AA seqDB search
MVVIVDDDELIRGSLAGLMKAAGLPALTFASADEFLISGEAERTACLISDIRMPGMSGLE
LQAKLNETHREIPIIFITAHGDEKFRLRALRAGAVEFLTKPFDDEALLDSVRAALEM
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgtgattgttgatgatgatgagttgattcgcggctcgcttgccggattgatgaag
gcggctgggcttcctgctttaacatttgcgtccgcggacgaattcctgatatccggcgag
gcggagcggacggcatgtcttatctctgatattcggatgcccgggatgtcaggtctggaa
ctccaggccaagctcaacgaaacccatcgcgaaattcctatcatctttatcacggctcat
ggcgatgaaaagtttcgattgcgagctcttcgcgccggagcagtggaatttctgactaaa
ccatttgacgacgaggcattgctcgacagcgtgcgtgcagcactcgaaatgtga

DBGET integrated database retrieval system