KEGG   Candidatus Koribacter versatilis: Acid345_3731Help
Entry
Acid345_3731      CDS       T00352                                 

Definition
(GenBank) sigma-24, ECF subfamily
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r4 IDO
Motif
Other DBs
NCBI-ProteinID: ABF42732
UniProt: Q1IK68
Position
complement(4407036..4407803)
Genome map
AA seq 255 aa AA seqDB search
MSLGRQPNQCQCRSNPSILWRRLWQSSCFCISRRKQMHTITRDENHRSRYRGCRNADNSG
VEGRQDSRVKRYASCVEFQQVFLKNLDSIFQLCVLLMGNDQNAEQYLLDAFDDCVLAQQV
FRDWALAWAKHTVIENAIRTLKSRPKNAELLRVPEQPSIEDSDTVEAPQANALAIMALRD
FERIVLVMSVFERYSDRHCALLLGCSVERIRAARTRALVQLSSSPESESAISVDRTKDAD
LTQAGPPLFTSVERL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgtcactgggacgacaaccaaaccaatgccagtgtcgatcaaacccctctattctctgg
cgtcggctgtggcagtcctcttgcttctgtatatcgaggagaaaacaaatgcacacgatc
acacgggatgaaaaccaccgcagtcggtatcgaggctgccggaatgcagataacagtggc
gtggaaggcagacaggattcacgggtgaaaaggtatgcgagctgtgtggaatttcaacaa
gtctttctaaagaacctcgattcgatatttcagctttgcgtgttgcttatgggcaatgat
caaaacgcagagcaataccttttggatgctttcgacgactgcgtgttggcccagcaagtg
ttccgagattgggcactcgcgtgggctaaacacacagtaatcgaaaacgcgatccgcacg
ctgaagtcgcgcccgaagaatgcggaattgctgcgggtgcccgaacagccgtcgatcgaa
gattccgacaccgtcgaagccccgcaagccaacgcgttggccattatggcgctgcgagac
tttgaacgcatcgtactagtcatgtctgttttcgaacgatattcggatcgacattgcgca
cttcttcttggttgctctgtcgagagaatccgtgccgcgcggactcgggcattagtgcag
ctctcctcctcacctgagagtgagagcgcaatatcggtggatcgaacgaaagatgctgat
ctaactcaagcaggtccacccttgttcacgtcggtcgaacggctctga

DBGET integrated database retrieval system