KEGG   Candidatus Koribacter versatilis: Acid345_3732Help
Entry
Acid345_3732      CDS       T00352                                 

Definition
(GenBank) hypothetical protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABF42733
UniProt: Q1IK67
Position
complement(4408060..4408299)
Genome map
AA seq 79 aa AA seqDB search
MPFYSQPNTCVQQHAGNVGSRFDPAKSDSDFPMLFCSLQCQREWISKCMSGLTLEDVFEI
QERARAVIGEWAVAATIGR
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgccgttctattctcagccaaacacatgtgttcaacagcacgcgggtaatgtcgggagc
cgtttcgatcccgcaaaatccgattccgattttccaatgctcttctgctctctccaatgc
caaagggagtggatttcgaagtgtatgagcgggctaacgctcgaagacgtgttcgagatc
caggagcgcgcccgtgccgtcatcggtgaatgggcggttgccgccaccattggtcgctga

DBGET integrated database retrieval system