KEGG   Candidatus Koribacter versatilis: Acid345_3734Help
Entry
Acid345_3734      CDS       T00352                                 

Definition
(GenBank) response regulator receiver protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-ProteinID: ABF42735
UniProt: Q1IK65
Position
4410067..4410723
Genome map
AA seq 218 aa AA seqDB search
MRAIAFPSSATSIGLRAGSVWSVVMSTEVSQGSLRVLPLLRILSGICASGSRQVHVCSSG
TLRASGYADRQTISGANLKNPNFLLTLKVLLVDDECDELELRAAILRLAGLSVLTAPGPI
EALSLVDSVGHIDVAVIDYEMPYMNGGALAACLKAKMPHLTIALYSAAIGIPSRDLTAAD
AFIPKAEGAFVLLQYLSRVSRALQPIYPDFTNSVKRLK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcaatcgcatttccatcttcagcaacttcgatcggcttacgggcgggttcggtt
tggagtgtcgtgatgtcaacagaggtgtcacaaggttcacttcgcgttttacccctttta
cgcatcttgtcagggatctgtgcgtcaggatcacggcaggtccacgtgtgcagctctggc
acgttgcgtgcttccggatacgccgacagacaaacgatttccggagccaatttgaaaaat
ccgaactttctcctcactctaaaagttcttcttgttgatgacgagtgtgatgaactggaa
ctgcgggctgcgattttgaggctggctggcctttccgtgctaactgcaccagggccaatt
gaagcgctgtctctcgtcgattctgtcggtcacatcgatgtcgccgtgatcgattacgag
atgccgtacatgaacggaggggctctggcggcgtgcctcaaggcgaagatgccacacctg
accattgccttgtactctgctgcaatcggtattccgtcccgcgatctgaccgctgctgac
gcctttatcccgaaagccgaaggcgcatttgtgttgctgcagtatctgtcgcgtgtatct
cgtgcactgcaacccatttatccggacttcacgaacagtgttaagaggctcaaatga

DBGET integrated database retrieval system