KEGG   Candidatus Koribacter versatilis: Acid345_3737Help
Entry
Acid345_3737      CDS       T00352                                 

Definition
(GenBank) peptide methionine sulfoxide reductase
  KO
K07304  peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11]
Organism
aba  Candidatus Koribacter versatilis
Brite
KEGG Orthology (KO) [BR:aba00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Acid345_3737
Enzymes [BR:aba01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.11  peptide-methionine (S)-S-oxide reductase
     Acid345_3737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMSR
Motif
Other DBs
NCBI-ProteinID: ABF42738
UniProt: Q1IK62
Position
4412622..4413149
Genome map
AA seq 175 aa AA seqDB search
MNILTERALIAGGCFWGMQQLLRRYPGVISTRVGYSGGDVSNATYRNHGTHAEAIEIIFD
PEQLTYRTLLEFFFQIHDPTTLNRQGNDRGTSYRSAIFYTSDEQKRIAIDTIADVNASGI
WPGKVVTEVEPAGAFWEAEPEHQDYLEYYPNGYNCHFIRPDWKLPRRSEKASFSS
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatattgaccgaacgcgcacttattgcaggcggttgcttttggggtatgcagcag
ctactgcgccgctaccccggtgtgatttcgacacgggtcggctattcgggtggcgacgta
tccaacgcgacctaccgtaatcacggcacccatgccgaggcaattgaaatcatctttgat
cctgagcagctcacttacaggacgctgctagagttcttcttccaaattcatgacccaacc
acgcttaatcgccaagggaacgacaggggaaccagctatcgttccgccattttctacact
agcgacgaacagaaacgaattgcaatagacaccatcgcggatgtcaacgcatcgggtatt
tggcccggtaaagtggtgactgaagtcgaaccggcaggtgctttttgggaagccgagccg
gaacatcaagattatctggagtactatccgaacggctacaactgccatttcattcgaccc
gactggaagcttccgcggcgatctgaaaaagcgtcttttagttcctaa

DBGET integrated database retrieval system