KEGG   Candidatus Koribacter versatilis: Acid345_3738Help
Entry
Acid345_3738      CDS       T00352                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: ABF42739
UniProt: Q1IK61
Position
complement(4413837..4414595)
Genome map
AA seq 252 aa AA seqDB search
MKATKALQDKVALITGGSSGIGLATAKRFVDEGAFVFLTGRREPELLAAANELGPSAIAI
RTDSSLISDVEKILARIRETKGKLDILFANAGIGEFLPLGVITEEHFDKIFSTNVKGIVF
LVQKALPLMPSGSSIVLNASIASIKGMPAFSIYSASKAALRSFARSWTTDLRRQQIRVNA
VSPGVISTPGYDGLGLSKQEMETFLKTNAETIPLGRVGTPDEVAKAVVFLSSDESSYISG
IELFVDGGLAQI
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaccaaagcacttcaagataaagtcgcgctcatcactggcggcagttcggga
ataggactcgcaacagcgaaacgcttcgttgacgaaggtgctttcgtgttccttacagga
cggagagaacctgagcttctggcggcggcaaatgagttgggtccaagcgcaatcgcgatt
cgcaccgattcttcgctcatctccgacgtggagaaaattctcgcaaggatcagagaaaca
aaggggaagctcgatattctgttcgcaaatgccggaattggtgagttccttccgttggga
gtgattaccgaggagcactttgacaagatcttctctaccaacgtcaaagggatcgtcttc
ctggtgcaaaaggctcttccactgatgccctcagggtcgagcatcgtcctcaatgcctcc
atcgcatcgatcaagggcatgccggcattcagcatctacagtgccagcaaggcagctttg
cgctcattcgcccgttcatggaccacagatctaaggcgacagcagattcgcgtgaatgcc
gtcagccctggcgtcatttccactccaggttatgacggcctcggtctttctaagcaagag
atggaaacctttctcaagaccaacgccgagacgattccacttgggagagtaggaaccccc
gacgaagtggcaaaggcggtggtattcctttcttcagacgagagcagctacattagcggc
atcgaactttttgtggacggcggactcgcgcagatctag

DBGET integrated database retrieval system