KEGG   Candidatus Koribacter versatilis: Acid345_3752Help
Entry
Acid345_3752      CDS       T00352                                 

Definition
(GenBank) primase P4-like protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: D5_N Alpha-E
Motif
Other DBs
NCBI-ProteinID: ABF42752
UniProt: Q1IK48
Position
complement(4428141..4430540)
Genome map
AA seq 799 aa AA seqDB search
MTPFYGVHEVRVLRESGVAVGYFNSWEAALNAVKSEPSYKGAYFTLNPVKLPTGVPLNPK
TLIAAHKTAGDSDIEKRIWLLIDVDPPRAANTNSTVSEKDAAREQAEQVRNYLSSRCWPQ
PELCDSGNGWHLLYHIELPNDYASTELVRGTLARLHDLFSMVDAGNFNASRLCKLYGTWA
RKGQHIEERPWRLSAIVSKGSETAVTAQQLGSISSIRLSSHKTPEQADDLNLSRLMEFLD
YYGVSVRSKPRSVRDGFRVEIECPWAEEHSGETRRDTTVSFIEGVGNGFHCLHSHCTERH
WREFRTELEKRHPGRLFSFGPEAVFGGGSLPLIAHATLAEAFLRDNHDFVCIYDQPKRPI
AQWVKTRWDISEDDTLLWRAVADYLKDLHPRYPKPEKGPDSRMRFYDAAFIGGVVRCVKP
YLPPVKGELFDRDPHLLGLPNCRLIDLRTNATRDMRREDYITQRIDVAPDPNCPTPRFDR
FISEITCGDGPLANYLLRLCALCLTAIPFQALFFLWGRGRNGKGVLIRTLTAILGDGKFA
WPLRPGEITVSKFGDEAAKRTFANLKGRRLATVNESVAGNLNTSMLKLISGGDTLTGANM
RQDQQAFKPTHKVLLPTNDRPQLPADPAFRGRVHMIPFLANFTGREDTNLDHVLQHVELP
GILYRFVTLCPDVIENGLRPPASVLAETEQLFSELDITKQFRDDCLEIVDGAETPAADVE
RVVNSWVREQSTTGIVVSSSGREGPDDVILRELKHQPDIKYSRLRRKTGETSPHGKGKAW
YFVGVRLKEEPPPATPATS
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgttttacggagtccatgaagtacgcgtcttgcgggagtccggtgtcgccgtt
ggatactttaattcttgggaagccgctctgaatgctgttaaaagtgagccgtcgtacaag
ggcgcctacttcacccttaacccggtaaagcttccaacaggggttccgctgaatccgaag
accctaatcgctgcgcataaaacggcgggcgattctgacattgaaaaacgcatttggctg
ctcatcgacgtggacccgcctcgggctgctaacacgaacagcacagtatctgagaaggac
gcagcgcgtgagcaagctgagcaggtgcgcaactacctcagcagccgatgttggccccag
ccggaattgtgtgactcggggaacggttggcacttgctttatcacattgaattgccaaat
gactacgcgtctacagaattggtgcgcgggacattagcacgcttgcatgacctcttttca
atggtggacgcgggaaacttcaacgcttcgcgattatgtaagctgtatggcacctgggcc
cgaaaggggcagcatatagaagagcgcccgtggaggctgtccgcaatcgtgtcgaaaggg
tcggagacagccgtgacggcgcagcaattaggttcgattagctctatacgcttgtcttct
cacaagacacctgagcaagcagatgatttgaacctgtctcgcttaatggagttccttgac
tactacggggtgtccgtgcgctcaaagccgcgctcagtcagagatggatttcgggttgag
attgaatgcccgtgggcagaggagcacagcggagagactcgcagggatacaacggtgtct
ttcatcgagggcgtaggcaacgggtttcactgtctgcactcgcattgcacggagcggcat
tggcgcgagtttagaaccgaattggagaagcgtcatccgggacggttgttttcgttcgga
ccagaggctgtgtttggtggcggttcgctgccgctcatcgcgcatgcgacattggctgaa
gcattccttcgggataaccacgattttgtgtgcatctacgaccaacccaaacggccaatc
gcgcagtgggtaaaaacacggtgggacatctctgaagatgacacgctcttatggcgtgcc
gttgcggactatctcaaggacctccatccccgttacccgaagccagaaaagggtccagat
tcccgtatgcggttttatgacgccgcctttatcggcggtgtggtgagatgcgtcaagcca
tacttgcctcccgttaaaggggaactgtttgaccgagacccgcacttgctgggtttgccg
aactgtcgattgattgaccttcgcaccaacgcaacccgggatatgcgtcgcgaagattac
atcacccaacgtattgacgtagcgccggacccaaactgtccaacgccccgcttcgaccgc
ttcatcagcgaaataacctgcggcgatggtccacttgcgaattacctgcttcggctttgt
gctctgtgtctgacggccatcccgttccaagctctttttttcctgtgggggcgtggccga
aatggcaaaggcgtccttatacgaacgctgaccgcaatccttggcgacgggaaatttgcc
tggccactccgcccgggtgaaatcacagtttcgaagtttggcgacgaagcagcaaagcgg
accttcgccaatttgaagggtaggcggctggcaacagttaacgaaagcgtcgcgggcaat
ctcaacacctccatgttgaaactgatttccggaggcgacacattgaccggtgcgaacatg
cggcaggaccagcaggctttcaagcctactcataaagtgctgttgccgacgaatgaccga
ccgcagctaccggcggacccggcctttcgcggacgcgtgcatatgattccattcctcgcg
aacttcaccgggcgtgaggacacaaacctcgaccacgtcttgcaacatgtcgagttgccc
ggaatcctctaccgcttcgtgacgctgtgccccgacgtcattgagaacgggttgcggcca
ccggcaagtgtgttggctgagacggaacagctcttctctgagttggatatcacgaaacag
tttcgcgatgactgcctggaaatcgtggatggtgcggagactcctgccgccgatgtggag
cgagttgttaactcctgggtgcgtgagcaaagtacgacgggtatcgtcgtctcatcgtcg
gggcgcgagggtcctgatgatgtgatattgcgcgaactgaagcaccagccagacatcaag
tattcccggctaagacgcaaaactggagagacatcacctcacggaaaaggtaaggcctgg
tacttcgttggcgtgaggctcaaggaagaaccacctccggccactccggccacatcgtaa

DBGET integrated database retrieval system