KEGG   Candidatus Koribacter versatilis: Acid345_3753Help
Entry
Acid345_3753      CDS       T00352                                 

Definition
(GenBank) McrC protein
  KO
K19147  5-methylcytosine-specific restriction enzyme subunit McrC
Organism
aba  Candidatus Koribacter versatilis
Brite
KEGG Orthology (KO) [BR:aba00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:aba02048]
    Acid345_3753
Prokaryotic defense system [BR:aba02048]
 Restriction and modification system (R-M system)
  Type IV R-M system
   Acid345_3753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: McrBC
Motif
Other DBs
NCBI-ProteinID: ABF42753
UniProt: Q1IK47
Position
complement(4431985..4433040)
Genome map
AA seq 351 aa AA seqDB search
MEIPVANVYYLLCYAWDKLEERDLVDIHPTEETDLVNLFARVLTNGIDHLLKKGIDRGYL
LHSEESCVLRGRIDFPQSIKHMLFQRAQAHCEFDELSFDVLHNRILKSTIMRLIRTRDLD
SGIRDRLLFQYRYFAEVGDLDLSVQIFGKVQLYRNNHFYDFLLRVCALLFENLLPTQEPG
NWRFRSFLQNREQMAYVFERFVRNFYKRELPSVRVDGRCKVKREDINWGMTPSDDLSSAL
LPKMQTDVCITTEAKRILVECKYVDDPLEQREEMAPKLITTHLYQVNAYLDNWPDLPLYR
SSRAILLYPLATRPIAVEFTRADGQLLSVRTLNLAQQWSAIHQDLLRLVDN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaaatccctgtcgcaaacgtctactacctcctttgttatgcttgggacaaactggaa
gagagagatcttgtcgatattcatccgaccgaagaaacggatttggtgaacctgttcgcc
cgcgttctgaccaacggtatcgaccatttgctgaagaaaggcatcgatcgtgggtaccta
cttcatagcgaagaatcctgcgtgttgcgtgggaggatcgattttccacaatcgataaaa
cacatgctctttcagcgagcgcaggcgcattgcgagtttgatgaattgagttttgatgtg
ctgcataaccgtattctgaaatcgacgattatgcgcttaattaggactcgtgatctagat
tcaggaattcgagatcgtttgcttttccaatatcgctactttgcggaggtcggggacctc
gatttatcggttcagatatttggcaaagtacagctttaccgtaacaaccacttttatgat
ttccttttaagggtctgcgcgctgctttttgagaatctgcttccgacccaagagcctgga
aattggcggtttaggtcgttcttgcagaatcgggaacagatggcgtatgtctttgagcgt
ttcgtacgcaacttttacaagagggaactaccaagcgtgagagttgacgggcgatgcaaa
gtcaagcgggaggacataaattggggcatgacaccttcagacgacctcagctcagctctg
cttcccaaaatgcaaaccgatgtgtgtatcaccaccgaggcaaaaaggatcttggttgaa
tgcaaatacgtcgatgatcctcttgagcagcgggaggagatggccccgaagctgattact
actcatctttaccaagtgaatgcttacctggacaactggcccgatttgccactctaccgc
tcttcccgcgccatattgttatatccactcgctacacgtccgatcgctgtcgagttcact
cgtgccgacgggcagctcctcagcgtacgcaccctcaatttggcccagcaatggtctgct
attcaccaagaccttcttagattggtggacaattga

DBGET integrated database retrieval system