KEGG   Candidatus Koribacter versatilis: Acid345_3754Help
Entry
Acid345_3754      CDS       T00352                                 

Definition
(GenBank) ATPase associated with various cellular activities, AAA_5
  KO
K07452  5-methylcytosine-specific restriction enzyme B [EC:3.1.21.-]
Organism
aba  Candidatus Koribacter versatilis
Brite
KEGG Orthology (KO) [BR:aba00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:aba02048]
    Acid345_3754
Enzymes [BR:aba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     Acid345_3754
Prokaryotic defense system [BR:aba02048]
 Restriction and modification system (R-M system)
  Type IV R-M system
   Acid345_3754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 AAA EVE IstB_IS21 Mg_chelatase AAA_14 AAA_16 AAA_22 AAA_24 NACHT AAA_11 ResIII RNA_helicase AAA_7 AAA_18 TsaE AAA_30 AAA_2 PhoH AAA_19 AAA_3 ABC_tran DnaB_C NTPase_1 RuvB_N AAA_33 RsgA_GTPase Sigma54_activat
Motif
Other DBs
NCBI-ProteinID: ABF42754
UniProt: Q1IK46
Position
complement(4433043..4435460)
Genome map
AA seq 805 aa AA seqDB search
MTTMNAVDKYLLEFKPSAAEWLSNQGPKEQYEFFRDFFTPKRLKKANWADFQKIGEHLNC
FAAMPLAKANALGRPNHPLKRYRESFEYLANGKDPVEERIRKFHGDDAYRLAYFGNSAVS
ELAGFLFPSEFVLFNARDQFAADFLKITPAFESTDDLVSKLTKFCDAVQPVAERYVQLVG
RQTDVPLNLEIDQFFSWIYTKYSGKKDAPTRFWVIGAGDRASEWKEFYEHNFVAIGWDEL
GDLTAFESLEQLQKRLEKIWPTDAKQRNNSRTCWDFANELHPGDAIFVKDGVKKAVGLGV
VESDYRFEADRSSYKHVRSVRWTWKGDFDLPHGLQLPLKTLTLLTNTDVLAALKKVATFT
ASATEEKNTQHWWINANPKIWNFSETPVGGRQVYTSHNERGNKRQKYKYFEEVKTGDWLI
GYVTSPDRELVALARVTKALGPQAPDGTEGIEFEKVEQVANPIPLHELQKNPALQSCEPI
LSNQGSLFRLTSEEFAVIRSLIDDLNPLAPTSHSAFSKKDALKALFLSEEQLDEIAFSLQ
DKKNVILQGPPGVGKTYVAKKLAYLLMKEVDSARVQMVQFHQSYSYEDFIQGYRPSDDGH
FELRNGHFFQFCRKAQRDPDKRPFIFIIDEINRGNLSKILGEVMMLIEPDKRGPEFAIPL
AYSGSADETFFVPSNVFVIGLMNTADRSLAMVDYALRRRFRFIGLKPEFKSERFSGFLLQ
AGAKQPLIKKIVSRLSTLNDEISGDEKNLGPGYRIGHSFFCPMDGRAPDEVWYRAVINSE
IKPLLDEYWLDDEDKVNSLIAALTE
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgactactatgaacgccgttgacaaatacttattggagttcaagccaagcgccgccgaa
tggctgtccaaccagggacccaaagaacaatacgagttcttccgcgactttttcactccg
aagcgcttaaagaaagctaattgggctgactttcagaaaattggcgaacacctgaattgc
ttcgctgctatgcctttagccaaagcgaacgccctcggtcgtcctaatcatccgctaaag
cgatatcgtgagagcttcgaatatctcgcaaatgggaaagatccagttgaagaacgaata
cgcaagttccacggagatgacgcttatcgattggcgtatttcggcaattctgctgtgagc
gaattggccggattccttttcccgagcgagtttgttctgttcaacgcccgagatcagttt
gcagcagatttcctgaagattacaccagcattcgaatctacggatgatcttgtatcaaag
ctaaccaaattttgcgatgctgtgcagccggtggccgagcggtatgtgcagctcgtaggc
aggcagacagatgtacccctcaatcttgaaatcgatcagttctttagctggatatacaca
aagtattccggaaagaaagatgcgcccacgcgcttttgggttatcggcgctggagaccgg
gcctcagagtggaaggagttctacgaacacaatttcgttgcgatcggctgggacgagctg
ggagatcttactgcgttcgagtcgctggagcagcttcagaaaaggttggaaaagatttgg
ccaaccgacgcaaagcagcgaaataacagccgtacctgctgggactttgcgaacgagttg
catccgggcgacgcaatcttcgtcaaggatggcgttaagaaggccgttggacttggggtt
gtcgagagcgattaccgttttgaggccgacaggtcttcttacaagcatgttcggtcggta
cgttggacatggaaaggcgactttgacttaccgcatggcctgcaactcccactgaaaacg
ttaacccttttgactaacacggacgtgctcgcggcattgaagaaagtggcgacatttacg
gcctctgcaacagaggagaagaacactcaacattggtggatcaacgcgaatccaaaaatc
tggaatttcagcgagaccccggtcggcggtagacaggtctatacatcgcataacgaaaga
ggtaacaagcgccaaaagtataaatattttgaagaggtcaagacgggggattggctgatt
gggtatgttacgagcccagaccgggagctcgtggcattagctcgtgtcacgaaagcgttg
gggccgcaggcgccggatggcacagagggcattgaattcgaaaaagttgagcaggtagcc
aatccgataccgttgcacgaacttcaaaaaaacccggccctacagagctgcgagcctatt
ttgagcaatcagggcagcctcttccgtttgacctccgaggaatttgcagtaattcgttca
ctgatcgatgacctaaatcctctcgccccgacgtctcatagcgccttctctaagaaagac
gctttaaaggcactcttcttaagcgaagagcagcttgatgaaattgctttctctcttcag
gacaagaaaaatgtgatcctccagggacccccgggagttgggaagacatacgtcgccaag
aaattggcgtatctgttgatgaaggaggtcgatagcgcgagggtgcagatggtgcaattt
catcaatcatactcttacgaagacttcattcagggttatcgtccgagtgacgatggccat
tttgagcttcgaaatggacacttttttcaattctgccggaaagcgcagcgcgatcccgac
aagcgcccattcatcttcatcatcgatgagatcaataggggtaatctgagcaagattttg
ggtgaagtgatgatgttaattgagccagataagaggggacctgaattcgcgatacctctt
gcgtattccggttcagctgacgagacgttttttgttccgagcaatgtcttcgtcatcggg
ctgatgaacactgccgatcgttctttagcaatggtcgactatgcgctgaggaggagattt
aggtttatcggtctgaagccggagtttaagagtgaacgcttttctggatttcttttgcag
gctggcgcgaaacagccactcatcaagaagattgttagccggttatccacactgaatgat
gagatctcaggcgacgaaaaaaacctcggcccgggatatcggatcgggcatagctttttc
tgcccgatggatggacgagctcctgacgaggtttggtaccgagccgtcatcaactccgag
ataaagccacttctcgatgaatattggcttgatgatgaagacaaggtgaattctctgatt
gccgctctgaccgagtaa

DBGET integrated database retrieval system