KEGG   Candidatus Koribacter versatilis: Acid345_3755Help
Entry
Acid345_3755      CDS       T00352                                 

Definition
(GenBank) type I site-specific deoxyribonuclease, HsdR family
  KO
K01153  type I restriction enzyme, R subunit [EC:3.1.21.3]
Organism
aba  Candidatus Koribacter versatilis
Brite
KEGG Orthology (KO) [BR:aba00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:aba02048]
    Acid345_3755
Enzymes [BR:aba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     Acid345_3755
Prokaryotic defense system [BR:aba02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   Acid345_3755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3387 SWI2_SNF2 HSDR_N ResIII
Motif
Other DBs
NCBI-ProteinID: ABF42755
UniProt: Q1IK45
Position
complement(4435635..4438724)
Genome map
AA seq 1029 aa AA seqDB search
MTTVSAFTESVVEEAALAWLEGLGYTVLSGPSISAGEIAAERIEADYSDVILERRVRQTL
QRLNPNLPPEALDDAFRRLTHDNETSLIANNHAFHQILVNGVTVEYNRADGSIGGALVRV
IDFEAAENNDWLAVNQFTIVEGQYTRRPDVLIFINGLPIALLELKNAADENATIWTAFKQ
IQTYKSQIPSLFAYNELLVISDGMEARVGSLTADTERFMPWRTIGGEELAPTSLPQLQVL
IEGLFERRRLLDFIRHFVVFEDEGRGVLIKKIAGYHQFHAVNRALRETLSASAEGGDRRV
GVVWHTQGSGKSLTMAFYAGRLVLEPTLQNPTIVVITDRNDLDDQLYGTFSRCHELLRQA
PLQALDREHLRSLVQVSSGGVIFTTIQKFMPAEGDKYPQLTDRRNVIVVADEAHRSQYDF
IDGFARHMRDALPHASFIGFTGTPIEKTDVNTRSVFGDYISIYDIQRAVEDGATVPIYYE
SRLAKLELPASEKPKVDTAFEEATEGEEVDRKEKLRTKWAAVEAVVGTEKRLNTVAKDLV
KHFEERLEVMDGKAMIVCMSRRICVDLYNEIMKLRPTWHSENDDAGVLKIVMTGSATDGP
EWQQHIRDKRRREALGKRFKNAKDPFKIVIVRDMWLTGFDVPSLHTMYADKPMRAHGLMQ
AIARVNRVFKDKPGGLVVDYLGIAHELKLALATYTESGGKGQTALPQEEAVARMIEKYEI
CRGLFHGFDWSMWLTGTSAQKLAILPNAQEHVLKQEDGKNRLLKAVSDLSKAFALAVPHD
AALKIRDDVGFFQAIRSVLAKTASQQYRPEQELDNAIRQIISRAMSSGEVVDIFAAAGLK
KPDISILSEEFLREVSNIPQKNLAVELLRKLLNDEIKSRSRRNVVKGKLFSAMLESSIHK
YQNRAIQAAQVIEELIGLAKEMREESAKGEELGLSEDEVAFYDALEVNDSAVKVLGEPTL
KTIARELVDTVRRNTTIDWAVRENIRANLRVLVKRILRKYGYPPDKQEKATLTVLEQAEA
LSANWAVTT
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgtctccgcgttcaccgaatctgtggtcgaagaggcggcgcttgcttggttg
gaagggctgggctacacggtactttccggcccaagcatttctgctggagaaattgccgcc
gagcggatcgaggctgattactccgacgttattcttgagcggcgcgttagacagacactg
caacgcctcaatcctaatctcccaccagaagcgttagacgacgcgttccgcaggctcact
cacgacaatgaaacgtctttgatcgctaataaccatgcctttcatcagattttggtgaat
ggcgttaccgttgagtacaaccgagccgatggttccatcggcggagccttggtgcgcgtt
attgactttgaggctgccgaaaacaacgactggctcgcggtgaaccagttcacgatcgtg
gagggacagtacacgcggcgacctgacgtgctgatatttatcaatggtctcccgatcgcc
ttgctggaactcaagaacgctgccgacgaaaatgccaccatttggaccgcgttcaagcag
attcagacgtacaaatcccaaattccatcgttgttcgcctacaacgaactgctcgtgatc
tccgatggtatggaggcacgagtcggatcgctcactgctgatacagagcggttcatgcct
tggcgcacaatcggaggcgaagagcttgccccgacatctctgccgcagcttcaggtgtta
atcgaggggcttttcgaaaggcgccgtttacttgacttcatacgtcactttgtcgtcttc
gaagacgaaggacgcggggtgttgatcaagaagattgctggatatcatcagttccacgcc
gtcaatagggcgttaagagagacgctgtccgcatcggcggaaggcggcgatcgcagagtg
ggagtggtgtggcacacacagggaagcggcaagagtctcacgatggctttttatgccggg
cgccttgtacttgagccgactcttcaaaatcccaccatcgtcgtgataacagatcgtaac
gacttggacgatcaactttacgggacattctctcgctgccatgagttgttgagacaggct
ccgctacaagccctggatcgagagcacttgcggtcactggttcaagtgtcgtccggaggc
gtgatcttcacaacaatccagaaattcatgccggcggagggcgacaaatacccgcagctt
acagatcgtcgcaacgtgatcgtcgtcgctgacgaggcacatcgtagtcaatacgacttt
atagatgggtttgcgcggcacatgagggatgccttaccccacgcctcatttattggcttc
acaggtacacccatcgaaaagaccgatgtaaatacgcgctccgtcttcggcgattacatc
agcatctacgacatccagcgagccgtcgaagatggggcgactgtgccgatctactacgag
agccgtctggcgaagctcgaactccctgcttcagaaaagcccaaggtcgatacggctttc
gaggaagccacagaaggcgaagaggtcgatcgcaaagaaaagctcaggacgaaatgggcc
gctgtggaagccgttgtgggaaccgagaagcggctcaatacggttgctaaagacctcgta
aagcacttcgaagagcggctagaggtcatggacggcaaagcaatgattgtctgtatgagc
cgccgaatctgcgttgacctgtacaacgagattatgaaacttcgtccaacgtggcacagc
gagaacgatgatgccggagtgctcaagatcgtgatgacggggtcagcaacggacgggccc
gagtggcaacagcacatcagggacaagcgacggcgtgaagcgttaggtaagagatttaag
aatgctaaagacccattcaagatcgtgatcgtaagggatatgtggcttacaggattcgac
gttccatcgttacacacgatgtacgcagacaagccgatgcgagcgcatgggctgatgcag
gcgattgcccgagtcaaccgcgtgttcaaagacaagcccggcggactggttgtggactac
ctcggcatcgcgcacgaactcaagcttgcgctggccacgtacacagaaagcggtggaaag
ggccagacggcgctgccgcaggaagaggctgtcgcaaggatgatcgagaaatatgaaatc
tgtcggggattattccacgggtttgactggtcaatgtggctcaccgggacctccgcgcag
aagctcgcgattcttcctaacgcccaggaacacgtcctgaaacaggaggacggaaagaac
agactgttgaaggcggtgtcagatttgtcaaaagcattcgcattggctgtgccccacgat
gcagctttgaagattcgtgacgatgtaggctttttccaagcaatccgaagcgtcttggcc
aaaaccgcttcgcaacagtatcgtcccgagcaagagctcgataacgcaattcgccaaatc
atatccagagcgatgtcctctggcgaagtggtggatattttcgcagctgcgggccttaag
aagcccgatatatcgattctttccgaagagttcctgagagaggtcagcaacatcccacag
aagaatctcgcagtagagctgctacgcaagctgctcaatgacgagatcaaaagtcgatcg
cggcgcaacgtcgtgaagggcaagctcttctccgcaatgttggagagctcgattcataag
tatcagaaccgggctattcaggccgctcaagtcattgaggagttaatcggactcgcgaag
gagatgcgagaagagtcggcaaaaggcgaggaactgggcctaagcgaagacgaggtggct
ttctacgatgcactcgaagtcaatgacagcgccgtcaaagtgcttggtgaaccaactttg
aagactattgcgcgcgagcttgtggacaccgttcgccgaaacacgacgatcgattgggcc
gtgcgcgagaacatccgtgcgaacctgcgtgtgctggtgaaacgcatcctgaggaagtat
ggatacccgccagacaagcaggagaaggcgaccctgactgtgctggagcaggcggaagcg
ttgtcagcgaattgggcggtgactacgtaa

DBGET integrated database retrieval system