KEGG   Candidatus Koribacter versatilis: Acid345_3758Help
Entry
Acid345_3758      CDS       T00352                                 

Definition
(GenBank) N-6 DNA methylase
  KO
K03427  type I restriction enzyme M protein [EC:2.1.1.72]
Organism
aba  Candidatus Koribacter versatilis
Brite
KEGG Orthology (KO) [BR:aba00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:aba02048]
    Acid345_3758
Enzymes [BR:aba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     Acid345_3758
Prokaryotic defense system [BR:aba02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   Acid345_3758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N6_Mtase HsdM_N MTS AviRa UPF0020 Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: ABF42758
UniProt: Q1IK42
Position
complement(4440674..4442209)
Genome map
AA seq 511 aa AA seqDB search
MANGTISEIDEAKLWSMADALRNNMDAAEYKHVVLGLIFLKYISDAFEAKHAELEQKMDQ
GADPEDPDEYRAVSIFWVPREARWAHLKDNAPQPKIGTLVDDAMAAIERDNQSLKGVLPK
DYARPGLDKQRLGQLINLVSGIGLGTPAARAKDILGRVYEYFLAQFASAEGKKGGQFYTP
SHVVRILVEMLAPYKGRVYDPCCGSGGMFVSSEKFIEAHSGKLGDISIYGQESNYTTWRL
AKMNLAIRGIDAQIQHGDTFHNDRHPDLKADCVLANPPFNDSDWRGELLKEDKRWVFGVP
PAGNANFAWIQHFIYHLAPTGLAGFVLANGSMSTNTSGEGEIRKGIIESDLVDCMVALPG
QLFYSTGIPVCLWFVARSKSSGRFRNRRGETLFIDARKFGSLIDRVHRELSDADVAKIAG
TYHAWRGDEGAGGYADVAGFCKAATLDDIRKHSHILTPGRYVGAKETEDDGEPIEQKMKT
LTDALRMQLAESRKLEGEITGNLKEIGYELA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtggccaacggaaccatctcagaaatcgatgaggcgaagctctggagcatggcagatgcg
ctgcgcaacaacatggacgctgcggagtacaaacacgtcgtcctcggtcttatcttcctg
aaatacatctccgacgccttcgaggcgaagcacgccgaacttgaacaaaagatggatcag
ggggccgatccggaggaccccgatgagtaccgcgctgtcagtatcttttgggttcccaga
gaagctcgttgggcacacctgaaggacaacgctccgcaacccaaaatcgggacgcttgtc
gatgatgcaatggcggcgattgagcgagataatcagtcgctgaagggcgtattgccgaag
gattatgcccggcctgggctagacaaacaaaggcttgggcaattgatcaatctcgtgagt
ggcatcggtcttggtacgcccgccgcccgggccaaggacatcttaggtcgcgtttacgag
tacttccttgctcagtttgccagcgctgaaggtaaaaagggcgggcagttctatacgccc
tctcacgtcgttcgaatcctcgtcgagatgctagctccgtacaaagggcgagtctacgac
ccatgctgcggatcaggcggcatgttcgtcagcagcgagaagttcatagaggctcacagt
ggaaaactcggcgacatctcgatctacggtcaagaatcgaattacacaacttggcgcttg
gcgaagatgaatctggcgattcggggcatcgatgctcaaatccagcacggcgacactttt
cacaacgatcgccacccagacctgaaggccgattgtgttctggcaaaccctcccttcaat
gacagcgattggcgcggggaactgctgaaggaggacaagcgttgggtcttcggtgtacct
ccggccggtaacgcgaactttgcatggatccagcacttcatctatcacctcgcgccgacc
ggcttggcgggcttcgtcctcgctaatggctcgatgtccacgaatacctcaggggagggt
gagatcaggaaaggcatcatcgaatctgatctcgtcgattgcatggtggcactccccgga
cagcttttctattcgacgggcattccggtttgcctttggttcgtcgcccggagcaagtcg
agtggtcggttccgtaaccgcaggggcgaaacgctcttcatcgacgcgcgaaagttcgga
tcgctgattgatcgtgtgcaccgggaattaagcgacgcggatgtcgccaagatcgccgga
acctatcatgcgtggcgtggtgatgagggcgcaggaggctacgccgatgttgcgggcttt
tgtaaggccgcaacgttggacgatatccggaagcacagtcacatcctcaccccgggacga
tatgtgggtgcgaaggagactgaagatgacggcgaaccaattgagcaaaagatgaagact
ttgacggacgcactgcgcatgcagttagcagagagcagaaaactcgaaggggagataacc
ggcaatctcaaggaaataggttatgaattggcctaa

DBGET integrated database retrieval system