KEGG   Candidatus Koribacter versatilis: Acid345_3759Help
Entry
Acid345_3759      CDS       T00352                                 

Definition
(GenBank) conserved hypothetical protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SEC-C HNH_5 HNH
Motif
Other DBs
NCBI-ProteinID: ABF42759
UniProt: Q1IK41
Position
complement(4442335..4443150)
Genome map
AA seq 271 aa AA seqDB search
MKHKFIGEACVYCGAEATTKDHILGRKFFLIGQRDNLPQVPACRDCNGRKAKYEAYLMTV
LPFGAKHPEAAKTLSALVPGRLEKNHKLRRKLEKGFSESGGTSVPIEHESLEALFAMIAK
ALLWIHYGVRCGTGFDAIGSIFHDQGEAFFRSVIGKGGQPVKRDFGDGAFSYEGSQATDC
PEATLWRFTVYGGVSFADSRMPGTASLAVAVTGPEKMIQNLRYRSVLNDPKPPKPGRNDQ
CPCLSGKKFKKCHGSLTATGSADHPLWFERD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacaaattcatcggcgaggcatgcgtttactgcggcgcggaagccaccaccaaa
gatcacatcttaggaagaaaattcttcttgatcggtcagcgcgacaaccttccgcaggtc
ccagcgtgccgcgattgcaatggtcgcaaagcgaaatacgaggcttatttgatgacggtc
ttgccgttcggagccaagcatcctgaggccgcgaagaccttgagtgcgctggtccccgga
cgactggagaagaaccataagctccggcgcaaactggagaaaggattttccgaaagcggc
ggcacgtcggttcccatagagcatgagtcactcgaagcgctattcgccatgattgcgaag
gccctgctgtggatccactacggtgtccgatgtggcacgggcttcgacgcgatagggtcg
attttccacgaccaaggcgaggcgttctttcgttcggtgataggaaagggcggacagccc
gtcaagcgagatttcggcgatggagcgttttcatacgagggatctcaggccacggactgc
cccgaggctaccttgtggcgttttacggtgtacgggggagtgtcgtttgcggactccaga
atgcccggtacagcatcgcttgcagttgcggtgaccggaccggaaaagatgattcagaat
cttcgctaccgttccgttttgaatgatcccaaacctccgaagccgggacgcaatgaccag
tgcccatgcctgagcgggaaaaaattcaagaagtgtcatggatcgctgacagcgactggg
tccgctgatcacccactttggttcgagcgcgactga

DBGET integrated database retrieval system