KEGG   Candidatus Koribacter versatilis: Acid345_3761Help
Entry
Acid345_3761      CDS       T00352                                 

Definition
(GenBank) hypothetical protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NucS
Motif
Other DBs
NCBI-ProteinID: ABF42761
UniProt: Q1IK39
Position
4444125..4445795
Genome map
AA seq 556 aa AA seqDB search
MPPFSEAELRDFLADNITRIEPGLTLLDKEKYIPNAIGTRGFIDLLAQDERGHFVLIELK
RSDAASREAIHEVHKYVEGVKRHLGARDDEIRVIVASTEWRELLLPFSQFLESTRITAEG
IRLIVGESGLPSLTAEKVEPVRVSRGRFLAPWHELNHYTSEDSLAKGILDYEHSCRLKGV
DDYVLVVFEASPDWYPLAQEEFRASMIQMQEQFGVHDPAEIDEMVAKLPNFRFALYFASQ
VLGREYCLEVLRQNSEDMEEHEEIIDGMEEEEALQYLNDAVHNLAPKKHRDGFEIGYPGK
FQTRFRVGNLWILKRIQRYGMFQRNTLLSEEEILEELAGSEGVTGQRFKRQITINNKSHI
ASAKDGLRECLEHNPVWLAHTLKIIDEIEKDYPELEASIDVFNPSTGLMTIYFAATRPEP
FAFIPLFTIAVRDGAATIRAYLGCLEGVSSPMSFQSLIDKYYDGQIGVLLLSVTWGGYEQ
RDTDILEDCGLFYRSFRVDDIGSTNAFSSLRDERWRPVPQFFPPEKFSEHLDHHGEFVME
LLREIGSRDKGSYFES
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccttctccgaagccgagctgcgcgactttctcgctgacaacataacgaggatt
gagccgggactgacgcttctcgataaagaaaagtacatcccgaacgcaatcggcacccgg
gggttcatagatttgctcgctcaggacgaacgcggccatttcgtactcattgagttgaag
cgcagtgatgctgcgtctcgcgaagccattcacgaagtacacaagtacgttgaaggtgtt
aaacgtcacttgggagcgagagacgacgagatccgtgtaattgtcgcctctacggaatgg
cgcgagctacttcttcccttttcgcaatttctcgaatcaacccgaatcacggcggaaggc
attcggttgattgtaggcgagagtggtctcccttctctcacggctgaaaaggtggagcca
gttcgcgtcagtcgcggtcgattcttggctccttggcacgaactgaaccactacacatct
gaggacagcctcgcaaagggcattctcgactacgagcattcatgtcgcctaaagggcgtt
gacgattatgttctggtcgtctttgaggcaagtcccgactggtatccgctggctcaggaa
gagtttcgggcctccatgattcaaatgcaggagcaatttggagtgcatgaccctgccgag
atagatgagatggtggccaaactgccgaactttcgtttcgctttgtacttcgcatcccag
gtgctcggacgagagtactgcctcgaagtactgcggcagaactccgaggacatggaagag
catgaagagatcatcgatggcatggaagaagaagaagcgctgcaatatctgaacgacgcg
gtccacaacttggcacccaaaaagcacagagacggctttgaaattggctatcccggtaag
tttcaaactcgattccgtgttgggaacctctggattctgaagcggattcagcgttacgga
atgtttcagaggaacacattgctctccgaggaagagattctggaggagctagccggaagt
gaaggagttacggggcagcgcttcaagcggcaaattacgatcaacaacaagagccacatc
gcatccgctaaagatggtctccgagagtgcctggaacacaaccccgtttggcttgcccac
accctgaaaatcatcgacgaaattgagaaggattatcctgagctggaggccagcatcgac
gtgttcaacccttcgactgggttgatgacgatatatttcgcagcaacccggcccgagccg
tttgcattcattccacttttcaccatcgcagtgcgggacggcgcggcgaccatcagagct
taccttggctgtttagaaggggtcagttcaccgatgagctttcaatcgttgattgacaaa
tactatgatggccagattggagtgttgctgctgtcggtaacgtggggaggctatgagcag
agggacacagacattctcgaagattgcggcctcttctatcgttcgttccgcgtagatgac
atcggatcgacgaacgcctttagcagtttgagagacgaacggtggcggccggtaccccag
ttttttccacctgagaagttctccgaacacctcgatcatcatggtgaatttgtcatggaa
cttcttcgcgagattggttctcgtgacaagggcagctacttcgagagctag

DBGET integrated database retrieval system