KEGG   Candidatus Koribacter versatilis: Acid345_3765Help
Entry
Acid345_3765      CDS       T00352                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE Response_reg Sigma70_r4_2 KORA
Motif
Other DBs
NCBI-ProteinID: ABF42765
UniProt: Q1IK35
Position
complement(4448282..4449115)
Genome map
AA seq 277 aa AA seqDB search
MSSEKIKTTNVTTLAPSAESNREFIRVVIADSEAIFRVGIRKIFALEDDFRVVAQAENLA
QAVAAVQKFPTDILLFEVTLSSTAGEAITEIVGKSPNTRIIAVGNDIGEHDTCDFLRRGV
TGILSRSVSPDLLVRCIRKVHSGETWLDNRGVNWVIEAYRAQAAQLMAPRNQPRLSEKEL
QIIAGVTQGMKNKDIAHEIGTTEQVVKNYLRKVYDKLGVSDRLELALYCMHHRLLEKARG
AVIGTGEQPKPSVPTQAQAMPIPQAPDGSKPNPTGQR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgaaaaaataaagaccacgaacgtaaccactctcgcaccctcggcggagagc
aaccgcgaatttatccgtgtcgtcattgcggattccgaggcgatttttcgcgtcggtata
cgcaagatcttcgctttggaggacgacttccgcgtcgtcgcacaggcggagaacctcgca
caggcggttgccgccgtacaaaagtttcccaccgacatcttgttgttcgaggtgacgcta
tcgagcacggcgggggaagcaatcaccgaaatcgttgggaagtcaccgaacacgcgaatc
atcgcggtcggcaatgacatcggcgaacacgatacctgcgacttcctgcgccgcggtgtg
accgggattttgtcacgctcggtgtctccagacctgctggtgcgatgcatacgcaaagtg
cattccggagagacgtggcttgacaatcgcggcgtgaactgggtgatcgaggcatatcga
gcccaggcggcacagcttatggcgccgcgtaatcagccgcgactcagtgagaaggaactg
caaatcatcgccggcgttacgcaggggatgaagaacaaggacatcgcgcacgaaatcggc
acaaccgagcaggttgtcaaaaactatctgcgcaaggtctacgacaaactcggcgtctcc
gatcgtcttgaactcgcactctactgcatgcatcaccgactgctggagaaggcgcgcggc
gcggtgattggcaccggagaacagccgaagccttccgttccgacacaggcgcaagcgatg
ccgattccgcaggctcctgacgggtcgaagcccaatccgaccggccagcgataa

DBGET integrated database retrieval system