KEGG   Candidatus Koribacter versatilis: Acid345_3766Help
Entry
Acid345_3766      CDS       T00352                                 

Definition
(GenBank) peptidase U62, modulator of DNA gyrase
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PmbA_TldD
Motif
Other DBs
NCBI-ProteinID: ABF42766
UniProt: Q1IK34
Position
complement(4449616..4451013)
Genome map
AA seq 465 aa AA seqDB search
MLTREQAHDIFGVLRKSTSCDEVELLVSGGNFALTRFANNGVTQNVSEENYSFSVRVNLD
GRTARATTNKRDAESLKRVVEQAEALARVQQQDPDLLPMPTPREVASHSEGLPDAPPSRY
FEATAAMTAGDRAQQVERMVTAGRKHGLTAAGTYSSGAHMEGVFNSRGVTQWHEQSSAEA
SITMLGENSSGWQKANSTNADDFDAAKLAEIAAEKASLSADPKELPAGKYTVVLEPSAVL
DIVGFMFWDFSGLALLDQRSFLNDRVGKQIFGDELNISDDVYHPLQSGFAFDGEGMRRSR
VNLVEGGVPKRVTFARATAALMAKSELGRKVGSVQATGHGFALPNEMGEAPMNIVFAPPK
DPKTVDQMVNNVEHGILVTRLWYIREVEPYEKILTGMTRDGTFLIENGKVKHGVRNFRFN
QGLIAMLSNIEAMSMPVRASGEESIDMVVPAMTVREFNFTEVTKF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccagagaacaagctcacgacatttttggagtcctgcggaagagtacttcctgc
gatgaagtagaactgctggtgagcggcggaaattttgcgctcacgcgcttcgccaacaat
ggtgttacgcagaatgtctcggaagagaactactcgttctccgtgcgcgtgaatcttgat
ggccgcactgcgcgagcgaccacaaacaaacgcgatgcggagagcctcaaacgcgttgtg
gaacaggcagaggccctcgctcgagtgcagcagcaagatcccgacctgctgccgatgccg
acgccgagggaagtcgcttcccattcggaagggctgccggatgctccaccatcgcgctac
ttcgaagcgaccgccgcaatgaccgccggggaccgcgcgcagcaagttgagcggatggtg
actgccggccgaaaacatgggctgaccgctgccggaacttattcttcgggcgcgcacatg
gaaggcgtcttcaactcacgcggtgtgacgcagtggcacgaacagagcagcgccgaagcg
tccatcaccatgctcggagaaaattcctcaggatggcaaaaagcgaactcgacgaacgcc
gacgacttcgatgccgcgaagctcgctgagatcgctgccgagaaggccagcctttccgct
gatcccaaggaactccccgccgggaaatacacggtcgtcctggagccatctgctgttctc
gacattgtcggcttcatgttttgggatttcagcggactcgcactgctcgaccaacgttcg
ttcctcaacgatcgagtgggaaagcaaatattcggtgacgaactgaatatcagcgacgat
gtttatcatccgctgcaatctggattcgctttcgatggcgaaggcatgcgccggagtcgc
gtcaatttggtggaaggtggagtgccgaaacgcgttaccttcgcccgtgccacagcggcg
ctgatggcgaaatcggagcttggccgaaaggtcgggtcggtgcaggcgactggacacgga
ttcgcattgcccaacgaaatgggcgaggccccgatgaacatcgtgtttgcaccgccgaaa
gaccctaaaactgttgaccaaatggttaacaatgtcgagcacgggatcctggtgacgagg
ctctggtatatccgggaagtagagccctacgagaagattctgaccggtatgacgcgtgac
ggtaccttcctgattgagaacggaaaggtaaagcacggggtgcgaaatttccgtttcaac
caggggttgatcgcgatgctgtcgaatatcgaggcgatgagcatgcctgtccgggccagc
ggcgaggagagtattgatatggtggttccggcgatgacggtacgggagttcaacttcact
gaagtaaccaagttctag

DBGET integrated database retrieval system