KEGG   Candidatus Koribacter versatilis: Acid345_3785Help
Entry
Acid345_3785      CDS       T00352                                 

Definition
(GenBank) macrolide glycosyltransferase-like protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-ProteinID: ABF42785
UniProt: Q1IK15
Position
complement(4472660..4473457)
Genome map
AA seq 265 aa AA seqDB search
MDFVCFRKYETRFNEVIGPIHARFNAFLADHGEAAYPVGQFFEASPYLNLLLYPEAVKFR
RSQPLDPARFQYLEGCVRQEQAYTIPQFRSNSDKPLVYVSFGSLGCGDTKTLQKLIGALA
QLPVRALINVGGYLEAYSDVPGNIILDRWFPQPSVIPQVDAVIHHGGNNTFTECLYFGKP
SIIMPYVWDGHDNATRVHETGHGIKMHRNHWTFAELRSNLTTILTSESMKRQLAATSGQM
RQAPGPAKAAKLLDGLLERHSVQTA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgtgtgtttccgcaaatatgaaacgcgatttaacgaagtgattgggccaatt
catgcgcggtttaacgctttcctcgcggatcatggtgaagcagcgtacccagttggccaa
ttcttcgaggcgtctccttatctcaatttgctgttgtatcccgaagcggtgaagttccgc
cggtcgcagccgctcgatcccgcacgattccaatacctggaaggatgtgttcgacaagag
caggcgtacacaattccgcaattcaggagtaatagcgataagccgctcgtgtacgtcagc
ttcggttctcttggctgtggcgatacgaagacgttgcagaagctgatcggcgccttggcc
caattgccagtacgtgctctgatcaacgtgggcgggtatctggaagcgtatagcgatgtg
ccggggaacattattctcgacaggtggttcccgcagccgtcggtgatacctcaggtagat
gcggtcattcatcatggcggaaacaataccttcacggaatgtctatatttcggcaaaccg
tcgatcatcatgccgtacgtgtgggatggacacgacaacgcgacgcgcgtgcatgagacc
ggccatggaatcaagatgcatcgcaaccattggacattcgccgaactgcgctcgaacctt
acgacgatccttaccagcgagtcgatgaagcgacaattggcagccaccagtggccaaatg
cgtcaagctcctggacccgctaaagcggcaaaattgcttgacggcctgctggagcggcac
tcggtgcaaacggcatga

DBGET integrated database retrieval system