KEGG   Candidatus Koribacter versatilis: Acid345_3786Help
Entry
Acid345_3786      CDS       T00352                                 

Definition
(GenBank) macrolide glycosyltransferase-like protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABF42786
UniProt: Q1IK14
Position
complement(4473429..4473962)
Genome map
AA seq 177 aa AA seqDB search
MREKKVIAFFPEAAYGPALNSVGIAQACKALGHDPVFLTAPDMAGTYSGYGFPEHLVNMA
PPMPAEEVAQYWQNFINGHIPNFDKSPYEQIDNYVRDCWDAIVETALWAQKDLPRVLGEV
KPDLICVDNVILFPAIKQFGKPWVRIISCSENEIPDPMIPPHLSGCGENGFRVFPQI
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagaagaaggtcatcgcgttctttccagaggcagcttatgggcctgctttaaat
tctgtcggtatcgcacaggcttgcaaggcgcttgggcacgaccccgtcttccttaccgcc
ccggacatggctggtacgtactcggggtatggatttcccgagcatctcgtgaacatggct
ccgccgatgcctgccgaagaagttgcgcagtattggcagaacttcatcaacggccacatt
ccgaactttgacaagtcgccatacgaacaaattgacaactatgtgcgggactgctgggac
gcaattgtcgagactgcactctgggcgcagaaagatttgccgcgggttttaggcgaggtc
aagccagatctcatttgtgtggacaacgtcatcctgtttcccgcgatcaagcagtttggc
aagccctgggtgcggatcatctcatgcagcgaaaacgagatccccgatcccatgattccg
ccgcacctttcggggtgtggcgagaatggatttcgtgtgtttccgcaaatatga

DBGET integrated database retrieval system