KEGG   Candidatus Koribacter versatilis: Acid345_3787Help
Entry
Acid345_3787      CDS       T00352                                 

Definition
(GenBank) HAD-superfamily hydrolase subfamily IA, variant 3
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ABF42787
UniProt: Q1IK13
Position
complement(4474045..4474761)
Genome map
AA seq 238 aa AA seqDB search
MRLAPRWLDTHPILCSAWERPARHSPAVNLEMPKPQLVLPPGDFQAYLFDCDGTVADSMP
LHFIAWTEALSEWGCLFSEERFYEWGGVPIVEIIERLGREQHITMPIADVARRKEQLYFE
HLPRLKAIPEVLEHIESHWGRIPFAVVSGSTRDSVEASLRMIGLIEKFKTLVCAGDYTKS
KPDPEPFLMAAQKLGVPPEACLVFEDTQMGIDAARAAGIAWVRVPDPRTRSNSEATKL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcggttggcgccaaggtggttggatacgcatcccatcctatgctcggcatgggaacgc
ccggcgcggcatagcccagctgtaaacttggaaatgcccaaaccccaactcgttctcccg
cccggcgacttccaagcgtacttgtttgattgcgatggtaccgtcgctgactcgatgccg
cttcacttcatcgcctggaccgaagcgctttcggagtggggctgcctcttttctgaggaa
cgtttctacgagtggggcggcgtgccgatcgtcgagattattgagaggctggggcgggaa
caacacatcacgatgcctatcgcggatgtcgcgaggcgcaaggaacaactctacttcgaa
catttaccgaggttgaaagccatccccgaggtgctcgagcacattgaatcgcactggggt
cgcattccgtttgccgtggtttccggcagtacccgtgattccgtcgaagcttccttaaga
atgatcggtctcatcgagaagttcaaaactcttgtgtgcgccggggactacacgaaaagc
aagcccgatcctgaaccgttcctgatggccgcgcagaagctgggagtgccgcctgaagca
tgtcttgtattcgaggacacgcaaatgggaatcgacgctgcgcgagctgcggggattgca
tgggtgagagtgccagatccgcgcacgcgttccaacagcgaggcaacgaagctgtga

DBGET integrated database retrieval system