KEGG   Candidatus Koribacter versatilis: Acid345_3791Help
Entry
Acid345_3791      CDS       T00352                                 

Definition
(GenBank) glycosyl transferase, group 1
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_1_4 Glycos_transf_1 Glyco_trans_4_4 Glyco_transf_4 Glyco_trans_1_2 Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: ABF42791
UniProt: Q1IK09
Position
complement(4477059..4478345)
Genome map
AA seq 428 aa AA seqDB search
MAKNKQRNILIIVQNLPVPFDRRVWQEATSLQRAGFGVTVISPKKKIYKKTHEILEGVEV
YRYPLIYEADAGVLGYFVEFVYCWLATLCFAVIAYARRPFHAIHACNPPDTYFALALLFR
IFGVKFVFDHHDLCPEMFVAKGRSKQGILYKGLLFLERRTLRSADMVIAVNQSHFDISEQ
RGGIRPERIAIVRSGPRRAWADLDATKPELKNGRQHMVTYLGEMCKQDGVDILLESIAHY
KSKYGESDTLFVFVGGGPDQQRLRNLATEMGLQGMTHFTGRVSDEDLWAYLSTSDVCVDP
DPLTEWSNLSTMNKMIEYLAFGRPVVAFKLREHFNTAQDCALYVEPNDEKSMAESIRSLL
LNSALRQEMSQKGRDRFRSDLAWENSEVVLVARYSELLGYQPSGYATAQLTTKKPLPDDQ
LQRAPEVP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaacaagcagcggaacatcctgatcatcgtccagaacctccccgtgcccttc
gacaggcgggtttggcaggaggccacgagcctgcagcgcgcgggctttggggtgaccgtc
atttctccaaagaaaaagatctataagaagacccatgagatcctggagggagtagaggta
tatcgctatccgctcatctatgaggcagacgccggcgttctcggatacttcgtggagttt
gtgtactgctggctggcgactctgtgttttgcggtgatcgcatacgcgcgacggccgttt
catgcaattcatgcgtgcaatccgccggatacgtacttcgcgttagcgctgctctttcgc
atcttcggggtgaagttcgtcttcgaccatcatgacctctgtccggagatgttcgtagcg
aagggccgctcgaagcagggaattctctacaagggtcttctttttctcgaaagaaggacc
ctgcgttccgctgacatggtgatcgctgtgaatcagtcacattttgatatctccgagcag
cgcggtggaatccggcccgaaagaatcgcgattgttcgcagcggcccgcggcgcgcatgg
gccgacttggacgcgacaaagccggagttgaaaaacggccggcaacacatggtcacgtat
ctcggagaaatgtgtaaacaggatggcgtggatatcctgctcgaatcaatcgctcattac
aaatccaagtatggcgaatccgacacgctcttcgtcttcgtgggagggggcccggatcag
cagcgcttgcgcaatctcgcaaccgagatgggtctgcaagggatgactcacttcacgggg
cgtgtttccgacgaagacctttgggcgtacctctcaaccagcgatgtgtgtgtggatcct
gatcccctgacggagtggagcaatctctcgacgatgaacaagatgatcgaatacctggcg
tttggccggccggtcgtggcgttcaaactgcgggagcatttcaacactgcgcaagactgc
gcactgtacgtggaaccgaacgacgaaaagagcatggctgaatccatacgcagcctgctt
ctgaatagtgcgcttcgccaggaaatgtcgcagaaaggcagggaccgcttccgaagcgat
ctggcctgggagaattcggaagtcgttcttgtagcgcgatatagcgagcttttgggctat
cagccgagtggctatgctactgcgcaactgacaaccaagaaacccctgcctgacgatcaa
ctccaaagggcacccgaggtaccgtga

DBGET integrated database retrieval system