KEGG   Candidatus Koribacter versatilis: Acid345_3792Help
Entry
Acid345_3792      CDS       T00352                                 

Definition
(GenBank) GDP-mannose 6-dehydrogenase
  KO
K00066  GDP-mannose 6-dehydrogenase [EC:1.1.1.132]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00051  Fructose and mannose metabolism
aba00520  Amino sugar and nucleotide sugar metabolism
aba02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Acid345_3792
   00520 Amino sugar and nucleotide sugar metabolism
    Acid345_3792
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Acid345_3792
Enzymes [BR:aba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.132  GDP-mannose 6-dehydrogenase
     Acid345_3792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPG_MGDP_dh_N UDPG_MGDP_dh UDPG_MGDP_dh_C NAD_binding_2 3HCDH_N ApbA NAD_Gly3P_dh_N TrkA_N AlaDh_PNT_C GFO_IDH_MocA NAD_binding_11
Motif
Other DBs
NCBI-ProteinID: ABF42792
UniProt: Q1IK08
Position
complement(4478351..4479640)
Genome map
AA seq 429 aa AA seqDB search
MNISIVGLGYVGAVSAACLASRGHNVWGVDINADKVAALNEGKSPIIEPKLAELLSAAVS
SGKLRATCDMSEALAQTDICFVSVATPSRKNGQIDAGHLLRACQQIADVIKLLDRKQVIV
IRSSVLPSVFEEATKLFATHVPGLAELCINPEFLREGSAIADYENPPFTVIGTDKPEVEK
MLRDLYSDLSAPVYVLGAKEATLVKYASNAFHALKVAFANEIGAVCHENGIDGDAVMEVF
CKDNKLNISHRYLRPGFAFGGSCLPKDVRALLYAGKVADIELPLLRGVLDSNECVIERAF
DAILETGARRIGLVGLSFKKNTDDLRESPFVELAERLVGKGLALRIYDPNVSVARLVGAN
REYIQQRLVHLSSLLTESIEELAVACDLIIIGHKFEGVEKLQAHRDRYHILDLTGPFALH
PRQSAAKAG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctctattgtgggtctgggatatgtaggtgcagtttcagcggcgtgcctggcg
agccgagggcacaatgtctggggcgtggatatcaacgccgacaaggttgctgcactgaac
gaagggaagtcgccgatcatcgagccaaagctcgctgaattgctctctgcggcggtttcg
agcggcaaactgcgcgccacgtgcgacatgtccgaagctctcgcacaaacagacatttgc
ttcgtctcggttgcgacgccgagccggaagaacggccagatcgacgccggccacttgctg
cgggcctgtcaacagatagcggatgttatcaagttgctagatcgcaaacaggtcatcgtc
atccggagcagtgtgctccccagtgttttcgaagaggcgacgaagctgttcgcgacgcat
gtgccagggttggcagaactttgcatcaatccggagtttttgcgtgaaggctcggcgatt
gccgactacgagaacccaccttttacggtgatcggtactgacaagccggaggtagagaaa
atgctccgcgacttgtactccgatctcagcgctccggtgtacgttcttggcgctaaggaa
gcgacgttggtgaagtacgccagtaatgccttccacgctctcaaagtcgcattcgcgaat
gaaatcggagcggtctgccacgagaacggtatcgacggtgacgctgtaatggaagtgttt
tgcaaagacaataagctgaacatctctcatcggtatttgcgccctggctttgcttttggt
ggttcctgtcttccgaaagatgtgcgtgccctcctctatgccggcaaggttgcggacatt
gagttgccattgctgcgcggcgtgttggatagcaacgagtgcgtgattgagcgtgcgttc
gacgcgattctcgagacaggtgctcgtcgcatcggtctcgtgggcttaagctttaagaag
aacaccgacgatctccgcgaaagcccattcgttgaactggcggagcgcctcgttggcaaa
ggactcgccctgcgaatctatgacccgaatgtctccgtggcacgcctggtgggcgcgaat
cgtgagtacatccaacagcgattggtgcatctttcctctctgctcacagagtcgatcgaa
gaactcgctgtagcgtgcgacctcatcattattgggcacaagttcgaaggcgtcgaaaaa
cttcaggcccatcgcgatcgatatcacatactcgacctgaccggtccattcgcacttcat
ccacggcaatcggctgccaaggcaggatag

DBGET integrated database retrieval system