KEGG   Candidatus Koribacter versatilis: Acid345_3795Help
Entry
Acid345_3795      CDS       T00352                                 

Definition
(GenBank) CapK protein, putative
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00360  Phenylalanine metabolism
aba01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aba00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Acid345_3795
Enzymes [BR:aba01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     Acid345_3795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding DGCR6
Motif
Other DBs
NCBI-ProteinID: ABF42795
UniProt: Q1IK05
Position
complement(4483709..4485136)
Genome map
AA seq 475 aa AA seqDB search
MNYGSKLQRSLYFSMPFSVKNICASLYGKNQRRLRYGRFYNEALALLVDSQWWDSSRLLD
HQSEEIQKFMSESVLRTAFYREHSAYAQMRSTRTVKDAPILTKQTVRSLQDQLCREELNQ
LAVRWAHTSGTTGKSLHFPISQYCFQREYAFRELHYMWANVSLLSGEPIAACQGHPVAHY
DRKTPPFWVEDSANQLLILSSYHMSPKNFSAYAKALDAWQPVMINGYPSSVYLLALAYQR
YGQGRVRPRGIFTTSETLFDYQREAIEAAFGCRVFDWYGNSEMCGNIVQCELGERHLKME
HSLIEIVDEHNDPISPGETGRLLCTGFGNHAFPLVRYDIGDRVVLSKNQVSRCGRSGVLI
HEIAGRSEDYIVAADGRYVGRLDHLFKDSQNVVEAQVVQTAAGKVVLRVVRTPEYGAPDE
RAIREEAALRLGSDTSVEFEYCESIPRGANGKFPFVLTQGRQGGNAATLSRVGIG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaattacggctcaaagctgcagcgcagtctgtatttcagcatgccgttctcggtgaag
aatatttgtgcgagtctttacgggaagaaccagcggcgattgcgttacgggcgtttttat
aacgaggcgctggcattgctggttgattcgcaatggtgggatagttcccggttgctcgac
catcaaagcgaggagattcagaagttcatgagcgaatcggttctccggacagctttttac
cgcgaacattccgcttatgcacagatgcggagcacccgaacagttaaggatgcgcccatt
ctgacgaaacaaactgtacgaagccttcaagaccagctctgtagggaagaattgaaccag
ttggcggttcgctgggctcacacaagcggcacgacaggaaagtctctgcacttcccaatt
tcgcaatattgctttcagcgtgaatatgcatttcgcgagctgcactatatgtgggccaat
gtcagccttctttcaggcgagccgatcgccgcgtgccaagggcatcctgttgcccactat
gaccgaaagacgccgcctttctgggtagaggactcagcaaaccagttgctgattctctcc
tcgtaccacatgtcgccgaagaatttctcggcctatgcaaaagcgctcgacgcatggcag
ccggtcatgattaatggctatccatcgtcggtctatttgttggcgctggcctatcagcgc
tatggccaaggacgggttcggccacggggtatcttcacaacctctgagacgttgttcgac
tatcagcgcgaagccattgaggcggcttttggatgtcgtgtcttcgactggtacggcaac
tccgaaatgtgcggcaatattgtgcaatgcgaactaggcgaacgccatttgaaaatggag
cacagcctcatcgagattgtagatgagcacaacgatcctatttctcctggcgagacgggg
cgtctgctctgcacaggattcggcaatcatgcttttccgctggttcgctatgacattggt
gaccgggtcgtactttccaagaaccaagtttctcgatgcggccggagcggggttttaatt
catgagatcgcaggtcgtagcgaagactacatagttgccgctgatgggcgctacgttgga
cgtctcgatcatttgttcaaagacagtcagaacgtagtcgaagctcaagtcgttcaaacc
gcggcaggaaaggtcgtgttacgcgtggtacgcactcctgaatacggcgcgcccgacgag
cgagcgattcgcgaggaagctgcgcttcgattggggtcagacacctcggtcgagtttgag
tattgcgagagtattccgcgcggtgcgaacggaaagtttccgttcgtgctcacacaaggt
cgccaaggcggaaacgctgctacgctttcgcgcgtcggcatcggatag

DBGET integrated database retrieval system