KEGG   Candidatus Koribacter versatilis: Acid345_3796Help
Entry
Acid345_3796      CDS       T00352                                 

Definition
(GenBank) hypothetical protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF362
Motif
Other DBs
NCBI-ProteinID: ABF42796
UniProt: Q1IK04
Position
complement(4485133..4486686)
Genome map
AA seq 517 aa AA seqDB search
MPSFPWSYSNSMNRYGQHNAEPKVAIHRSSGQVRYPKLPPFHPSDQYPELAVGLPIGTEQ
NSVYDAVRESFRLLGLDSANFGMAAWNPLSSLIQPGDHVFLKPNMIAHKHQLTDEWEHVI
THGSVIRAVVDYAYLALQGKGQITLGDAPQTDSKFELIIERMGLKAIQELYAKTQNFEIA
MVDLRKEHWIERDGIYVETVPLDGDPAGSIQVSLNNDSLFSELDGKGKTYYGAHYNVPET
NSHHCDGKHEYLISRSPVSADVFISIPKLKTHKKCGITLNLKGLVGINADKNWLPHYVLG
SPGAGGDQFDRDSSKQKLENSLVLKAKSFLVKGNPVVRYISRKTKRAAYRIFGNNENVVR
SGNWHGNDTVWRMSLDLNRILLYANPDGSMRSTDSPKRYFSVVDGFIAMEGNGPVAGTAK
ECGVVIAGGDPVAVDDVCTQLMGFDFEKLLLIRRAFESHRYPLTIASHHSIRTCSNLADW
TGKLVEWPHQSLYEFRPHFGWLGKVELERDAVAGMPT
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgccaagctttccttggagttatagcaattcaatgaatcgttacggacaacataatgcc
gagcccaaagttgcgattcatcgcagctccggtcaggtgcggtacccaaagctgccgccg
tttcacccgagcgatcaatatccagaacttgcagtcggccttccgatcggaacggaacag
aactccgtatacgatgctgtgcgagagtcctttcggctgcttggtcttgattccgcaaac
ttcggcatggcagcgtggaatcctctgtcttctctcattcagccgggcgaccatgtgttt
ctgaaaccaaacatgatcgcacataagcatcagctcaccgatgaatgggaacatgtcatt
actcacggctcggtaatccgtgccgtagttgactatgcgtatcttgcgctacaaggtaag
ggccagataacgcttggcgacgctccacaaacggattcgaagtttgagctgatcatcgaa
cgaatgggattaaaagcgattcaggagctctacgctaagacccagaatttcgagatcgcg
atggtcgatctccgtaaggaacactggatcgaaagagatggaatttatgtcgagacggta
ccccttgatggagacccagccgggagcattcaggtaagtctcaacaacgatagtttattt
tccgagcttgatggcaaaggcaagacctactatggggcgcactataacgttccggagacg
aacagccatcactgtgacggaaagcacgaatatctcatttcgcgtagtccagtttcagct
gatgtattcattagcattccgaagcttaagacccacaagaagtgtggaataacgctaaat
ctcaaaggcttggtcgggatcaacgccgataagaattggttacctcattatgttttaggt
tcacctggtgcgggaggcgatcagttcgatagagactcatcaaaacaaaagctcgagaac
tcactcgtgctcaaggcgaagagcttcctggtgaaggggaaccctgtggtgcgctacatt
tcacgaaagacgaaacgggcggcataccgcatctttgggaacaatgagaacgttgtgagg
tccggcaattggcacggtaacgatacggtttggagaatgtcgcttgatctaaaccggatc
ctactgtatgccaatcctgacggctcgatgaggagtaccgatagtccgaagcgatatttc
tcagttgtggatggattcattgcgatggagggaaacggcccggttgccggtacggcgaag
gagtgtggggtcgtcattgccggtggagatccggtcgccgtcgacgatgtttgtacccaa
ctgatgggcttcgattttgagaagttgcttcttattaggagggcgttcgaatctcatcgc
tatccgttaaccatcgcctcgcaccactcgatccgtacctgcagcaatctcgcggattgg
actggcaaacttgttgagtggcctcaccaatcgctttacgagtttcggccgcattttgga
tggcttggcaaggtcgagttagaacgtgatgcagtcgccgggatgccgacatga

DBGET integrated database retrieval system