KEGG   Candidatus Koribacter versatilis: Acid345_3800Help
Entry
Acid345_3800      CDS       T00352                                 

Definition
(GenBank) hypothetical protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzy_C
Motif
Other DBs
NCBI-ProteinID: ABF42800
UniProt: Q1IK00
Position
complement(4490244..4491641)
Genome map
AA seq 465 aa AA seqDB search
MYLTQTRLQNVWLKALMACLVGYALLGKGFAYLFIGECVLVAGFAIFLLSRRATLVASDS
VLLLWGLFAFWGACRTIPFLSTYHFDAIRDAVLWGYGLTALFIVASVNSAEQIASGLNAY
RKFLRWYMPLLPIILLLSGPLRPLMPVVPWSRDAAIVMLKPGDASVHLAAAALFWLILER
QSSARKRRGFSAMQGVAIAGWFGATMFVLVRTRAGVLAIIIPMALVSLLKLRRVAWKVGV
FAVAGTFLLAMILESNLIQINIHGRKFSSEQITNNLYSIAGQGDEKTDLENTKVWRLIWW
RHIVQYTVFGPYFWTGKGFGINLVLQDGPPHVTEDDKTTRSPHNGSMTVLARMGVPGLVM
WASLNLVFLFRMLRAYRRAARSGAQFWASVNLWVLCYWIAAFINLSFDVYIEGPVGGILF
WSIIGFGVSCLRVQSYEARQIAHGRVRNFHTRSAEQLAVRELSPS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtaccttacacagacaaggctgcagaacgtctggctgaaagcgctaatggcttgcttg
gtaggttatgccctactaggcaagggtttcgcataccttttcataggggaatgcgttctc
gttgctgggttcgcgatattcttactttctcgcagagcgacgttagtggcgagcgatagt
gtgcttttactctggggactcttcgccttttggggggcctgccgaactatcccatttcta
tcgacgtaccacttcgatgcgatccgagacgcagtcctttgggggtacggtcttaccgcg
ctgttcattgtggcgtccgtcaatagcgcggagcaaattgcgagtgggcttaacgcctac
cgcaagttccttcgctggtacatgccattattgccaattatcctcctgctatccggtcct
ttgaggccgctgatgcccgttgttccgtggagtcgagacgctgccatcgttatgttgaag
cccggtgatgcaagtgtccatctcgcggcagctgcacttttctggttgatccttgagagg
cagagctccgcgcggaagagaagaggtttctcggccatgcaaggcgttgctatagccgga
tggtttggcgctacgatgtttgtactagtcagaactcgtgctggggttcttgccatcatc
attccgatggccctggtttcacttctgaaattgcgaagagtagcctggaaggttggcgta
tttgccgttgcaggaactttcctgctggcaatgatcttggaatcgaatctgatccagatc
aatatacacggccgtaaattcagttcggagcagattacaaacaacctgtatagcatagcg
ggccaaggagatgagaagaccgatcttgagaatacaaaggtgtggagacttatctggtgg
aggcacatagttcaatacactgttttcggcccttatttctggactggaaaaggcttcgga
atcaatctggtgttgcaagatggcccgccccatgtaacggaggacgataagacaacgcgt
agccctcacaatggaagtatgacagtgctagcgcgcatgggagttcctggtctcgtgatg
tgggcctcgctgaatctcgtgtttctcttccgaatgctccgggcctaccgccgcgctgcc
cgatcgggagcccagttctgggcttcggtgaatctatgggttctatgttattggattgct
gcttttatcaacttgagtttcgatgtttacatcgaagggccagtgggtggaattttgttt
tggtcgattatcggcttcggcgtgtcctgcctgcgcgtacagagctatgaagcgcgtcag
attgcgcacggccgagtgagaaattttcataccaggtcagcagagcagttggcggtcagg
gaattatcgccatcctga

DBGET integrated database retrieval system