KEGG   Candidatus Koribacter versatilis: Acid345_3801Help
Entry
Acid345_3801      CDS       T00352                                 

Definition
(GenBank) hypothetical protein
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_pyruv_trans KH_5
Motif
Other DBs
NCBI-ProteinID: ABF42801
UniProt: Q1IJZ9
Position
complement(4491655..4492809)
Genome map
AA seq 384 aa AA seqDB search
MNITLVSTLNFNPGDEFIRLGMEHVLRQKFPDARLRPIHKHDPRTLFSGFSQKRSTPHRL
LSPMLYRLYAGGPGRKQENYLESADIVVFAGTPFIWRNSPVLFRSTCANAEWVSPIWERL
FDELRQVPVLNLAAGTSVSNQEQIDAITNDSTVSGFLKRALSRAQVTTVRDQISRDILGH
LGFPVKTIPCSSILSAKGAFLEPQEPEYVAINLMRSASHSGRGHRGRPDEWRKSIERVVP
EIEKRHRILFVSHSVDEDQTAAEWFPQHPRIVSKDPIVLLKAYSKALYGLCNRVHGAAAV
ATFGRPAIVVGGDSRINLIEQFGLPAYDHRQIDGPKLIERVEHIERNYDDYVRRLAAKID
DTQKAYLAALEQVLVQERQMAIGQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgaatatcacgcttgtctcaacgctcaactttaatccgggcgatgagttcattcgctta
ggtatggaacacgtacttcgtcaaaaatttccggacgcaaggttgcgcccaattcacaaa
cacgatccaaggacgctgttttctgggttctcccaaaaacggagcacgccgcaccggctg
ctctcccctatgctttaccgtttgtacgccggcggcccaggccgtaagcaagagaactat
ctcgagagtgctgatatcgtggtatttgctggtacaccgttcatctggcgcaattcaccc
gttctgtttcgatccacctgcgccaatgccgagtgggtctcgccgatctgggaacgatta
tttgacgagttgcgacaagtacctgtattgaatctcgcggcgggcacaagcgtttcgaat
caggagcaaattgacgcgatcacgaatgattctacggtgagcggattccttaagcgcgca
ttgtcacgagctcaagttacgacagtgcgcgaccagattagccgcgatatcctcggtcat
cttgggttccccgtcaagactatcccatgttcttctattctctcagcaaaaggagccttc
ctcgagcctcaggaaccagagtatgttgcgatcaatctgatgcgctccgcttcgcacagt
ggtcgcggccatcgcggccgtcccgacgagtggcggaagtcgatcgaaagggttgtccct
gaaatcgagaaaagacaccgcatcctatttgtctcccattccgtggatgaagatcagacc
gcggcagaatggtttcctcagcatccaaggatcgtaagcaaagacccgatcgtcttgctt
aaggcttattcgaaggcactctatggactatgcaatcgagtgcatggtgcagcggcggta
gcaacattcggccgcccggcgatagttgtcggaggtgacagtcgcatcaacctgatcgag
cagtttggactgccagcctacgatcaccggcagatcgacggtcctaagttgatcgagcgt
gttgaacacattgagcgcaattacgacgactacgttcggcgtctcgccgcgaaaatcgat
gacactcagaaggcgtatctggcggcgctggaacaagttttggttcaagagcgacaaatg
gcgatcggacaatag

DBGET integrated database retrieval system