KEGG   Candidatus Koribacter versatilis: Acid345_3804Help
Entry
Acid345_3804      CDS       T00352                                 

Definition
(GenBank) Protein-tyrosine kinase
Organism
aba  Candidatus Koribacter versatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_31 Wzz CbiA ParA GNVR MipZ AbiEi_4 DUF2721 AAA_26
Motif
Other DBs
NCBI-ProteinID: ABF42804
UniProt: Q1IJZ6
Position
complement(4495108..4497432)
Genome map
AA seq 774 aa AA seqDB search
MDSLFRKSELPPLGVSEQSTTNAGLEDEDLSLRQVIRILRKRKNLILGAAGACLACALLL
SFVMRSYYNSSATIEIQKDQDASLGSALDTLASTVGGGSGDTKTEVQTQVAILQSDDLAI
ETIERTGFEKHIGSYWHLFPSGRVTSEQGLPLRNAPRQREAMLKKFGKALTVTPIPDTRL
IQIAFEDPDPNFAAQVLNTLIGQYTQDVLTRRNASTTQASEWMSAQIKDLNQQVEAAQQK
LINYEKESGLIAITATDPKNPAAAPVLHIPALDRLTALNQDLVTAEASRVTREALYRLAR
SGDLDRLTSLGAESLTSPTDQAQAAMFTNLQALRQRQSQLKQQMASAVQIYGARNPHLVD
VDKQLSDVDSQIKGELKLIVDRTELDLELARQSEDALRQAYEKQEQEANKINDSQIRLAV
LQQEADSTRQLYETLYGRLEVSKLDEGIKSTNVAVISAGLPPAKPSHPDPLVNGIVGLGG
GLFVGLILAFVVETLDDSVATTTDAEELTGIAVLGVIPIVNENPRVLRAAGRAKANGSNG
SKPGRPTAMVYEQAMATEAFRSLRTTLLLSQAGSAPKSLLLTSSLPGEGKSTTTYGLGRC
FGSLGTRVLLIDADLRRPTLHKHAMKENDRGLSNLLTSVAEPSDFIQKDSSAPNLDILCA
GPIPPNPAELLASNVFSDLLKRVVLEYDLVLIDSPPAMLVSDAAIISSRVDGVVLVARAG
IITRAALGKAVEVLRRNKAPLRGLVLNAVNTKGTDYYYSHGYYGYDSYGSNGNA
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggactccttgtttagaaaatcggaattgcctcctctcggggtttccgaacaatccacg
acaaacgccggactcgaagacgaagatctgtctctaaggcaggtcatcaggattttacgg
aaacgcaagaacctgattctcggggccgccggtgcctgtcttgcttgtgcgcttttgttg
tcatttgtgatgcggtcctactacaacagttccgcgacgattgagattcagaaggaccag
gatgcctccctaggaagtgccctcgataccctggcgagtacggtgggcggcggaagcggc
gacacgaagacggaggttcaaacgcaagtcgcgattttgcagagcgatgaccttgcgatt
gagacgatcgagagaaccggctttgagaaacacatcgggtcgtattggcacctgtttccc
agtgggcgcgtgacttcggaacaagggctgccgttacgcaatgccccgcgtcaacgtgaa
gcaatgttgaagaaattcggaaaggcactcacggttacgccgattccggatacgcgtttg
atccaaatcgcgttcgaagaccccgacccaaattttgctgcgcaggtactcaacaccctt
attggccaatacacacaggacgtgcttactcggcgaaatgcatccacaacgcaagcatcg
gagtggatgagcgcacagatcaaggacttgaaccagcaggtagaagcggcgcagcaaaaa
ctgatcaattacgagaaagagagcggattgatcgcgattaccgccactgatccgaagaat
cccgccgctgcaccggtactgcatatacctgctttggaccgattgactgcactgaatcaa
gatctggtgacagctgaggcatcgcgtgtcacgcgagaagcgctgtaccgtcttgcgaga
tcgggagacttggatcgcctcacgagtctgggcgcggagtcgctcacttctccgacggat
caggcgcaggcggcgatgtttacgaacctccaggccctgcgtcaacgccaatcgcaattg
aagcaacagatggcgtcagcagtacagatctacggagccagaaatccacatttggtggac
gtcgacaaacaactatcggatgtcgactcccaaattaagggcgagcttaagctgattgtc
gatcgtacagagctagatctcgaactcgcgaggcagtcggaagacgcattgcggcaagcc
tatgagaagcaggagcaggaagcgaacaagatcaacgactcccagattcgactcgcggtg
ttgcagcaggaggccgactcgacgcgacagctctatgagaccctctacggacgcttggag
gtttcgaagctggatgaaggtatcaagagcacgaatgtcgcagtcattagcgccggacta
cctcccgctaaaccctctcatccggatccgctcgtcaacggaatcgtcggtttagggggc
gggctcttcgttggattgattttggcgtttgtggtcgaaacgttggatgactccgttgcc
accacgactgacgccgaggaattgactgggatcgccgtcctcggtgtgatcccgattgtg
aatgagaatccgcgggttctgcgcgcagcaggacgcgcgaaggccaacggaagcaatggg
agtaagccggggcggccgaccgcgatggtctacgagcaagcgatggccaccgaggcattt
cgctcgctgcgcacgacgctgttgttgtcgcaagcgggatcggcgcccaagtcgctactc
ttaacaagctcattgcctggagaagggaaatccaccacgacgtatggattgggcagatgc
tttggcagcctaggaacacgcgtcctactaatcgacgccgacttgcgcagaccgaccctc
cataagcacgcgatgaaggagaacgaccgcggcctaagtaatctgttgacgtcggtcgca
gaaccgagtgatttcattcagaaggactcgagcgcgccaaacctcgacattctttgtgcg
gggccaattccgccgaatcccgcagaattgctggcttcgaacgtgttctcggacctcctc
aagcgagtggtacttgaatacgacctcgtgctgattgatagcccgccggcaatgctggtt
tccgatgcggcgatcatctcgtctcgagtggatggcgtggtgctggtcgcacgcgccgga
ataatcactcgcgcagcgctgggcaaagcagtcgaggtcttgcgccgaaacaaggcgcct
ctgcgcggattggtgctaaatgccgtcaataccaagggcaccgactactactattcccat
ggttactatgggtatgactcgtacggctcgaacgggaatgcttaa

DBGET integrated database retrieval system