KEGG   Candidatus Koribacter versatilis: Acid345_3805Help
Entry
Acid345_3805      CDS       T00352                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
aba  Candidatus Koribacter versatilis
Pathway
aba00521  Streptomycin biosynthesis
aba00523  Polyketide sugar unit biosynthesis
aba01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aba00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Acid345_3805
   01055 Biosynthesis of vancomycin group antibiotics
    Acid345_3805
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Acid345_3805
   00525 Acarbose and validamycin biosynthesis
    Acid345_3805
Enzymes [BR:aba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     Acid345_3805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind NAD_binding_4 adh_short DapB_N NmrA UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABF42805
UniProt: Q1IJZ5
Position
complement(4497634..4498578)
Genome map
AA seq 314 aa AA seqDB search
MRIVVTGAAGFLGSHLCDALLAEGHDVVGVDNFVTGSAGNLEHMARDSRFGFVEHDICEP
FDVGAFDFLFQFASPASPIDYIEHGVETLKVGSVGNFNCLEYARRYNAGFLLASTSECYG
DPLEHPQRETYWGNVNPIGPRSVYDEAKRFAEASTMAFFRYHGVNTRIVRIFNTYGPRLQ
VNDGRVISNLMKQALLGEDMTIYGDGKQTRSFCYVADEVEGILRLSRTEEHFPTNIGNPK
EFTILECAELVKEVTGSSSSIRFEPMPQDDPKQRKPDISKAKSLLGWEPRVSLEEGLRMS
LPYFSDCLAALRAG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgtggtgacgggagcagctggatttctcggctcgcacctttgcgatgcttta
ttggccgagggccatgacgtcgttggagtcgacaattttgtgactggtagcgccgggaac
ctggagcacatggcgcgagattccaggttcggatttgtcgagcatgatatctgtgagccg
tttgacgtcggcgcatttgattttttgtttcaatttgcatcgccggcaagcccgattgac
tacatcgagcacggcgtggagacactgaaggttgggtcagtaggaaatttcaattgcctc
gaatacgcgcgacggtacaacgccggcttcctactcgcctcgacctcggagtgttacggc
gacccgctggagcatccgcagcgcgagacgtattgggggaacgtaaatccgatcggcccc
cgatccgtctacgacgaagcgaagagatttgcggaagcgtcaacgatggcattcttccgg
tatcacggtgtgaatactcggatcgtgagaatttttaacacgtatggccctcgactccag
gtgaatgatggtcgtgtcatatcgaacctgatgaaacaggcccttttaggcgaggatatg
accatctatggcgatggcaagcaaacgcggagtttttgttacgtagccgacgaagtggag
ggcatcttacgcctctcaagaactgaagagcactttccgacgaacatcggaaatcccaaa
gaattcacaattctagaatgtgccgagttggtcaaggaagtgaccggatcatcctcgtca
attcgcttcgaaccgatgccgcaggatgacccaaaacagcgcaagccagatatttcgaag
gcgaagtcgctgctgggatgggagcctagggttagcctcgaggagggattgcgaatgtct
ttgccgtatttcagcgattgtctcgccgcgcttcgcgcggggtga

DBGET integrated database retrieval system